KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr1553Help
Entry
C770_GR4Chr1553   CDS       T02405                                 

Definition
Protein-L-isoaspartate carboxylmethyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smeg  Sinorhizobium meliloti GR4
Brite
Enzymes [BR:smeg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     C770_GR4Chr1553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1624775..1625389
Genome map
AA seq 204 aa AA seqDB search
MALRLRSGGIVNHELLKAVEQTPRTLFAPPQYQDEVYSKRLIPLECGSFMEGCDMAVRLL
HCLNLKPGQRILEVGTGSGFTAAVMGRIAERVLTIDRYQTLVASAQKNLEKAGLRNVVVR
QADGSAGVPGEGTFDRILITAAFNSLPRTFSDHLVSGGTLLVPIMMSETHCRIVRVNRTG
SRFDREDLFDAPYLPIVPQVASFL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcggcttcgctcgggcggcatcgtcaatcatgagctgctgaaggctgtggag
cagacgccgcggacgctcttcgctccgccgcaataccaggacgaggtctactccaaacgg
ctcattccgctcgagtgcggttccttcatggagggctgcgacatggccgtccggctcctg
cactgtctcaatctcaagcctggccagcgcatactcgaggtcggaaccggcagcggcttt
accgcggccgtgatggggcggatcgccgagcgcgtgctgacgatcgacaggtatcagaca
ctcgtcgcatcggcgcagaaaaacctggagaaggcgggcctgcgcaacgtcgtcgtccgc
caggccgatggcagcgcaggagtgccgggcgagggcaccttcgaccggattctcattacc
gccgcattcaacagccttccccggacgttctccgatcatctcgtttcgggcggcaccctg
ctggtgccgatcatgatgagcgaaacgcattgccgcatcgttcgcgtcaaccgtaccggt
agccgcttcgaccgggaagatctgttcgacgcgccttacctcccgatcgtcccacaggta
gcgtcgttcctttag

DBGET integrated database retrieval system