KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr1837Help
Entry
C770_GR4Chr1837   CDS       T02405                                 

Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00220  Arginine biosynthesis
smeg00250  Alanine, aspartate and glutamate metabolism
smeg00471  D-Glutamine and D-glutamate metabolism
smeg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C770_GR4Chr1837
   00220 Arginine biosynthesis
    C770_GR4Chr1837
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    C770_GR4Chr1837
Enzymes [BR:smeg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     C770_GR4Chr1837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Totivirus_coat
Motif
Other DBs
NCBI-ProteinID: AGA06768
Position
complement(1904202..1905149)
Genome map
AA seq 315 aa AA seqDB search
MREPKPQEDLQAIIDDIYRELTPRLGEGKVADYIPQLARVDARHFGMAIVTTGGEVYRVG
DAEMPFSIQSISKVFTLTLALGKHGENIWNRVGREPSGSAFNSIVQLEHEGGKPRNPFIN
AGAIRISDLILAGHTPKELIGEIVRFVRYLADDENIVIDHEVARSETATGYRNIALANFM
RSFGRLDHPVEHVLGVYFHHCALAMTCSQLAKAGLFLAAGGTNPLTGHSVVSRQRARRIN
ALMLTCGHYDGSGDFAYRVGLPGKSGVGGGIMAVAPGKASIAVWSPGLNDYGNSLLGSLA
LEMLAARTGWSVFGP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagccgaaaccgcaagaagacctccaggcgatcatcgacgacatctatcgggaa
ctgacgccgcgcctcggcgaagggaaggtcgcggactatatccctcagctcgcacgcgtc
gatgcccgtcacttcggcatggcgatcgtcacgacgggtggcgaggtctatcgcgtcggc
gatgcggagatgccgttctccattcagagcatctccaaggtgttcacgctcacgctggcg
ctgggcaagcacggcgaaaacatatggaaccgggtggggcgagagccttcgggctcggcc
ttcaattcgatcgtccagctcgagcatgagggtggcaagccgcgcaaccccttcatcaat
gccggcgcgatcaggataagcgacctcattctcgccggccacacgccgaaggaactgatc
ggcgagatcgttcgcttcgttcgttacctcgcggatgacgagaacatcgtgatcgaccac
gaagtcgcacgctcggagacagcgaccggataccgcaacatcgcgcttgcgaatttcatg
cggtccttcggccggctcgatcatccggtcgagcacgtgcttggcgtctatttccatcat
tgcgcgctcgccatgacctgcagccagctcgccaaggccgggctgtttctagccgccggc
ggcaccaacccgctgaccggacattcggtcgtgtcgcgccagcgcgcgcggcggatcaat
gcgcttatgctcacctgcggccattatgacggctccggcgattttgcctaccgcgtcggt
ctgccggggaagagcggcgtcggcggcggcatcatggcggtggcgccgggcaaggcatcc
attgccgtctggtcgccgggactcaacgattacggcaattcgctgctggggtcgctggcg
ctggagatgctggctgcgcgtacgggttggtcggtgttcgggccgtaa

DBGET integrated database retrieval system