KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr2179Help
Entry
C770_GR4Chr2179   CDS       T02405                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C770_GR4Chr2179
   00670 One carbon pool by folate
    C770_GR4Chr2179
Enzymes [BR:smeg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     C770_GR4Chr2179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2260481..2261044)
Genome map
AA seq 187 aa AA seqDB search
MTEAEQKMTTRPKIVFVVAVAANGIIGREGDLPWRLSTDLKRFKALTIGKPVVMGRKTWA
SLGRPLPGRPNIVISRNPDFEAPGAEVAPSLETALTIARERAAAVGADEICIIGGGEIYR
QSIGMADVLHVTEVQAEVDGDTRFPSIDPATFEKVMEEDLPRSEKDSHAMHFVTWRRRTP
PPEGAGA
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggcggagcagaagatgacgacccgaccgaagatcgttttcgtcgtcgctgtc
gcggcgaatggaataatcggccgcgagggcgatctgccctggcggctttcgaccgatctc
aagcgcttcaaggcgctgacgatcggcaagccggtcgtcatgggacggaagacctgggcc
tcgctcgggcggcccttgcccggcaggccgaacatcgtcatcagccgcaaccccgatttc
gaggctcccggcgcggaggtggcgccgtcgcttgaaacggcgctcacgatcgcgcgggag
cgggcggccgcggtcggggccgacgagatttgcatcattggcggcggcgagatctaccgt
cagtcgatcggcatggccgatgtgctgcacgtgaccgaagtgcaggcggaggtggatggc
gatacgcgcttcccttctatcgacccggcgactttcgagaaggtgatggaggaagatctt
ccgcgcagcgagaaagacagtcacgcaatgcatttcgtgacctggcgccgccgcacgccg
ccgccggaaggtgcgggagcctga

DBGET integrated database retrieval system