KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr2291Help
Entry
C770_GR4Chr2291   CDS       T02405                                 

Definition
Ribulose-5-phosphate 4-epimerase and related epimerase and aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C770_GR4Chr2291
Enzymes [BR:smeg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     C770_GR4Chr2291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2385742..2386410)
Genome map
AA seq 222 aa AA seqDB search
MNELQLRQSIIDHCRHMNAIGLNQGTSGNISLRHGGTMLITPSAIPYAEMTPDMIVAMPI
EGEYGAWVGPKKPSVEWPFHLDILRARPDVGAVVHTHASFSTILAMARKPIPACHYMIAA
FGGSDVRVADYARYGTKALSENVLKAMEGRSACLMANHGMIATGSSLEKAMWAAVELETI
AKQYYHVLLIGGPVVLPQEEIAGVIEGFATYGHQDKPKGEAA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacttcaactgcgccagtcgatcatcgaccattgccgccacatgaatgcgatc
ggcctcaaccagggcacttcgggcaatatcagcctgcgccacggcggcacgatgctgatc
accccgtctgcgatcccctatgccgagatgacgccggacatgatcgtcgccatgccgatc
gagggcgagtatggcgcctgggtagggccgaagaagccctcggtcgaatggcccttccac
ctcgacattctgcgggcgcggccggatgtcggcgccgtcgttcatacccacgcgagcttc
tcgacgatcctcgcgatggcgcgcaagccgattcccgcctgtcactacatgatcgccgcc
ttcggcggttccgacgtgcgcgtcgccgattacgcccgctacggcacgaaggcgctgtcg
gaaaacgtgctgaaggcgatggaggggcgttccgcctgcctcatggccaatcacggcatg
atcgcgaccggttcgagcctggaaaaggcgatgtgggcggcggtcgagctcgagacgatc
gccaagcaatattaccacgtgctcctgatcggcggtccggtggtcctgccgcaggaggaa
atcgccggcgtcatcgagggatttgccacttacggccatcaggacaaacccaagggcgag
gccgcctga

DBGET integrated database retrieval system