KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr2291Help
Entry
C770_GR4Chr2291   CDS       T02405                                 

Definition
Ribulose-5-phosphate 4-epimerase and related epimerase and aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:smeg00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2385742..2386410)
Genome map
AA seq 222 aa AA seqDB search
MNELQLRQSIIDHCRHMNAIGLNQGTSGNISLRHGGTMLITPSAIPYAEMTPDMIVAMPI
EGEYGAWVGPKKPSVEWPFHLDILRARPDVGAVVHTHASFSTILAMARKPIPACHYMIAA
FGGSDVRVADYARYGTKALSENVLKAMEGRSACLMANHGMIATGSSLEKAMWAAVELETI
AKQYYHVLLIGGPVVLPQEEIAGVIEGFATYGHQDKPKGEAA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacttcaactgcgccagtcgatcatcgaccattgccgccacatgaatgcgatc
ggcctcaaccagggcacttcgggcaatatcagcctgcgccacggcggcacgatgctgatc
accccgtctgcgatcccctatgccgagatgacgccggacatgatcgtcgccatgccgatc
gagggcgagtatggcgcctgggtagggccgaagaagccctcggtcgaatggcccttccac
ctcgacattctgcgggcgcggccggatgtcggcgccgtcgttcatacccacgcgagcttc
tcgacgatcctcgcgatggcgcgcaagccgattcccgcctgtcactacatgatcgccgcc
ttcggcggttccgacgtgcgcgtcgccgattacgcccgctacggcacgaaggcgctgtcg
gaaaacgtgctgaaggcgatggaggggcgttccgcctgcctcatggccaatcacggcatg
atcgcgaccggttcgagcctggaaaaggcgatgtgggcggcggtcgagctcgagacgatc
gccaagcaatattaccacgtgctcctgatcggcggtccggtggtcctgccgcaggaggaa
atcgccggcgtcatcgagggatttgccacttacggccatcaggacaaacccaagggcgag
gccgcctga

DBGET integrated database retrieval system