KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr2601Help
Entry
C770_GR4Chr2601   CDS       T02405                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:smeg00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2723802..2724860)
Genome map
AA seq 352 aa AA seqDB search
MAWDEQKLNELKAKYGESHGGELFDPTFRKVADKIFTKSGTRLAPYSGIPTFLTAPHMPV
DADDPDFGNLQVAMIGVPMDLGVTNRPGSRFGPRALRAIERIGPYNHVLGCAPVHDLRVA
DIGDVPFRSRYRLEISHEDIEKRISQIVDAGVLPLSVGGDHSITHPILKAVGRKQPVGMI
HIDAHCDTGGAFDLTKFHHGGPFRNAVLDGVLDPTRVIQIGIRGSAEYLWEFSYESGMTV
IHAEEVTGLGIPAIIEKAKKIVGDGPTYLSFDVDSLDPSFAPGTGTPEVGGLTTREVLEL
IRGLKGVNLVGGDVVEVAPQYDTTTNTAHAGAQVLFEILSLMVFSPAVAGKG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggatgaacagaagctcaacgaattgaaggcgaaatatggcgagagccatggc
ggcgagctcttcgatccgaccttccgcaaggtcgcggacaagattttcacgaagagcggc
acgcggctggcgccctattccggcattccgacattcctgaccgcaccccacatgccggtc
gatgccgatgacccggatttcggcaatcttcaggtggcgatgatcggcgttcccatggat
ctcggcgtcaccaaccgcccgggttcgcgcttcggaccacgggcgctgcgcgcgatcgag
cggatcggcccctataatcacgtgctcggctgcgccccagtgcatgatctccgggtcgcc
gacatcggcgatgttcccttccgcagccgctaccggctcgaaatcagccacgaggacatc
gagaagcggatcagccagatcgtcgatgctggcgtcctgccgctctccgtcggcggcgac
cattcgatcacgcatccgatcctcaaggccgtgggcaggaagcagcccgtcggcatgatc
catatcgacgcgcattgcgataccggcggcgccttcgacctgaccaagttccaccatggc
ggcccattccgcaacgccgttctcgacggcgtgctcgacccgacacgcgtcatccagatc
ggcatccgcggctcggcggagtatctgtgggagttctcctacgagtccggcatgacggtc
attcatgcggaggaggtcaccggactgggtattccggcgatcatcgaaaaggcgaagaag
atcgtcggcgacggtccgacctatctctccttcgatgtcgacagcctcgacccgagtttc
gcgccgggcaccggtacgccggaagtcggaggtctgacgacgcgggaggttctggagttg
atccgcgggctgaagggcgtcaatctcgtcggcggcgacgtcgtcgaggtggcgccgcaa
tacgacacgaccaccaatacagcccatgccggcgcccaggtgctcttcgagatcctgagc
ctgatggtcttcagtccggccgttgccggcaagggctga

DBGET integrated database retrieval system