KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr2875Help
Entry
C770_GR4Chr2875   CDS       T02405                                 

Definition
Holliday junction DNA helicase, RuvA subunit (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:smeg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3004495..3005112)
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGTIDEIGEDHVVLDVHGVGYVAHCSARTLGKLGSAGEAAVLFIETYVREDQLKL
FGFLSALEREWFRLLQSVQGVGSKVALAVLSTLTPGELANAIALQDKTSISRAPGVGPKV
AVRIVTELKNKAPAFSGEMAPSIGLKQELGEGVAAAPVADAVSALTNLGYSRDQAANAVA
AALKNGGEGGDSAKLIRLGLKELSR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaagctcaagggcacgatagacgagatcggcgaggatcacgtggttctcgac
gtgcatggggtcgggtatgtcgcccattgctccgcgcgcacgctcggaaagctcggaagc
gctggagaggcggccgtactcttcatcgagacctatgtgcgcgaggatcagctgaagctg
ttcgggttcctgagcgcgttggagcgcgaatggttccgcctgcttcagagcgttcagggt
gtgggatccaaggtggcgctggcggtgctctccacgctgacccccggggaactcgccaat
gccatcgccttgcaggacaagacgtcgatctcgcgcgcgccgggcgtgggtccgaaagtt
gccgtgcgcatcgtcaccgaactcaagaacaaggctccggccttctccggcgagatggca
ccatcgatcggcctcaagcaggagctcggcgaaggcgttgccgcagcgccggttgcggac
gcggtctcggcgctcaccaatctcggctattcgcgagaccaggcggccaacgccgttgcg
gctgcgctgaaaaacggcggggagggcggcgacagcgccaagctgatccgcctcggcttg
aaggaactgtcgcggtga

DBGET integrated database retrieval system