KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr2934Help
Entry
C770_GR4Chr2934   CDS       T02405                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C770_GR4Chr2934
   00052 Galactose metabolism
    C770_GR4Chr2934
   00500 Starch and sucrose metabolism
    C770_GR4Chr2934
   00520 Amino sugar and nucleotide sugar metabolism
    C770_GR4Chr2934
Enzymes [BR:smeg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     C770_GR4Chr2934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3065273..3066160)
Genome map
AA seq 295 aa AA seqDB search
MTDKRKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPVIQYVVDEALEAGIEHLIFVT
GRSKAVIEDYFDIQVELDQTLRERNKKAEIELLEAMLPKAGTTSFTRQQAPLGLGHAVWC
ARDLVGNEPFALLLPDMIMKGEKGCLKGMVELYEESGGNVVAVEECAPDQAHKYGIVGVG
ETVGDGFRITRMVEKPAKGTAPSNFFINGRYILQPEIFPILETQERGAGNEIQLTDGMVK
LAEAQPFAAYHFRGDTYDCGAKDGFILANVAFALERGDIRPIVEGPLKTLLQGLK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcgcaaagtccgcaaagccgttttccccgttgcaggtctcgggacccgt
ttccttccggcgaccaaggcggttccgaaggagatgctgacggtggtggacaagccggtc
atccaatatgttgtcgatgaggcgctcgaagccggcatcgagcatctgattttcgtgacc
ggccgcagcaaggcggtcatcgaggactatttcgacatccaggtcgaattggaccagacg
ctgcgcgagcgcaacaaaaaggcggagatcgagctcctcgaagccatgctgccgaaggcc
ggcaccacgagcttcacccgccagcaggcacccctgggcctcggccatgccgtctggtgc
gcccgcgatctcgtcggcaatgagcccttcgctctgctcctgcccgatatgatcatgaag
ggcgagaagggttgcctcaagggcatggtcgagctctacgaagagtccggcggcaacgtc
gtcgcggtggaggaatgcgcgcccgaccaggcgcataaatacgggatcgtcggagtgggc
gagacggtcggcgacggtttcaggatcaccaggatggtcgagaagccggccaaggggacg
gctccgtcgaacttcttcatcaatggccgctacatcctccagccggagattttcccgatc
ctggaaacgcaggaacgcggcgccggcaacgagatccagctgaccgacggcatggtgaag
cttgccgaggcccagcccttcgccgcctatcacttccgcggcgatacgtatgactgcggc
gccaaggacggcttcatcctggcgaacgtcgccttcgctctcgagcgcggcgatatccgc
cccatcgtggaaggaccgttgaagacgctcctgcagggtcttaagtaa

DBGET integrated database retrieval system