KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr2971Help
Entry
C770_GR4Chr2971   CDS       T02405                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C770_GR4Chr2971
Enzymes [BR:smeg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     C770_GR4Chr2971
Exosome [BR:smeg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C770_GR4Chr2971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3110086..3112296
Genome map
AA seq 736 aa AA seqDB search
MTVPPGKDPAPAPPGMLPAPEIAAILSGTHSNPFAVLGVHAAGKTYVARCFVPGAETVIA
ETLSGKELGTLERRDEAGFFEGPVALRKEQPIRYRARNDGGEWTVIDPYSFGPVLGPMDD
YYIREGSHLRLFDKMGAHPIRHDGAEGFHFAVWAPNARRVSVVGSFNDWDGRRHVMRLRV
DTGIWEIFIPGVPVGTPYKYEIVDSNGTLLPLKADPFARRSELRPDTASMTADEIAQNWE
DEAHRRHWAEIDPRRQPISIYEVHAASWQRRDNGDMLTWDELAERLIPYCVDMGFTHIEF
LPISEYPYDPSWGYQTTGLYAPTARFGEPEGFARFVNGCHKVGIGVILDWVPAHFPTDEH
GLRWFDGTALYEHADPRQGFHPDWNTAIYNFGRQEVVAFLVNNALYWAEKFHVDGLRVDA
VASMLYLDYSRKHGEWVPNEYGGNENLEAVRFLQTMNTRIYGIHQGVLTIAEESTSWPKV
SHPVHAGGLGFGFKWNMGFMHDTLQYLSREPVHRKFHHNDMTFGLLYAFSENFVLPLSHD
EVVHGKGSLIAKMAGDDWQKFANLRAYYGFMWGYPGKKLLFMGQEFAQWREWSEDRGLDW
NLLEYNLHEGMRRLVRDLNGTYRSKPALHARDCEGDGFEWLIADDRENSVFAWLRKAPGE
KLVAVVTNFTPVYREHYDIPLPVAGRWKEVLNTDAEIYGGSGKGNGGAVHAEKRANGETI
ATITLPPLATLMLEQD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgacggttccgcccggcaaggatccagcccccgccccgccaggcatgctgccagcgccg
gaaatcgcggcaatactttccggtacccacagcaaccccttcgccgtccttggagtgcat
gccgcgggcaagacctatgtcgcccggtgcttcgtgccgggtgcggaaacggtgattgcc
gaaacgctcagcggcaaggaactcggcacgctcgagcggcgcgacgaggccggcttcttc
gagggtccggtggcgctccgcaaagagcagcccatccgctaccgcgcccgcaacgacggc
ggcgagtggaccgtcatcgatccctacagcttcggccccgtgctcgggccgatggacgac
tactatatccgcgagggctcgcaccttcgcctcttcgacaagatgggcgcgcatccgatc
cggcatgacggcgccgagggttttcacttcgccgtctgggcgccgaacgcccgccgtgtg
tccgtggtcgggagtttcaacgactgggacggacgccggcatgtcatgcgcctgcgtgtc
gacaccggtatctgggagatcttcatccccggcgtgcccgtgggtacgccctataaatac
gaaatcgtcgacagcaacggcacgctgctgccgttgaaggccgacccctttgcccggcgc
tcggagctcaggcccgacaccgcttcgatgaccgcggacgagatcgcccagaactgggag
gacgaggcgcatcggcgtcactgggccgagatcgatccgcgccggcagccgatctcgatc
tacgaggtccatgcggcctcatggcagcgccgcgacaatggcgacatgctcacctgggac
gaactggcggaaaggctgatcccctattgcgtcgatatgggcttcacgcacatcgagttc
ctgcccatttcggaatatccctatgatccgtcctggggctatcagaccaccggcctctat
gcgccgaccgcacgcttcggcgagccagagggctttgcccgtttcgtcaacggctgccat
aaggtgggcatcggcgtcatcctcgactgggtgccggcgcattttccgaccgacgaacac
gggcttcgctggttcgacggcaccgcgctttacgagcatgcggatccgcgccaggggttc
catcccgactggaacacggcgatctacaatttcggccgtcaggaggtcgtcgcctttctg
gtcaacaacgctctctactgggcggagaaattccatgtcgacggcctgcgcgtcgatgcg
gtcgcctcgatgctctatctcgactattcgcgcaagcatggcgaatgggtgccgaacgaa
tatggcggcaacgaaaatctcgaggccgtgcgtttcctgcagacgatgaacacccgcatc
tacggcatccaccagggcgtgctgaccatcgccgaggaatcgacgtcctggccgaaggtc
tcgcacccggtgcatgccggcgggctcggcttcggcttcaagtggaacatgggcttcatg
cacgacacgctgcaatatctctcgcgcgagcccgtgcaccgaaagttccaccacaacgat
atgaccttcgggctgctctacgccttcagcgagaatttcgtgctgccgctgtcccatgac
gaggtcgtccacggcaaggggtcgctgatcgccaagatggccggcgacgactggcagaag
ttcgccaatctccgcgcctattacggcttcatgtggggctatcccggcaagaagctcctt
ttcatgggacaggaattcgcccaatggcgcgaatggtcggaggaccgcggtctcgactgg
aacctgctcgaatacaatctgcatgaggggatgcgccgtctggtgcgcgacctgaacggc
acctatcgctcgaagccggcgctgcatgcgcgcgactgcgagggcgacggtttcgaatgg
ctgattgccgacgatcgtgagaattccgtcttcgcctggctgaggaaagcgcccggagag
aagctggtcgcggtcgtcaccaacttcactccggtttaccgggagcattacgacataccg
cttccggtggcagggcgctggaaggaagtcctcaataccgacgcggaaatctatggagga
agtggcaagggcaacggcggcgccgtccatgcagagaagagagcgaacggagagacgatc
gccaccatcacgctgccgcctctggcgacgctgatgctggagcaggattag

DBGET integrated database retrieval system