KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr3189Help
Entry
C770_GR4Chr3189   CDS       T02405                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00020  Citrate cycle (TCA cycle)
smeg00310  Lysine degradation
smeg01100  Metabolic pathways
smeg01110  Biosynthesis of secondary metabolites
smeg01120  Microbial metabolism in diverse environments
smeg01130  Biosynthesis of antibiotics
smeg01200  Carbon metabolism
Module
smeg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smeg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C770_GR4Chr3189
  Amino acid metabolism
   00310 Lysine degradation
    C770_GR4Chr3189
Enzymes [BR:smeg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     C770_GR4Chr3189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Fim-adh_lectin
Motif
Other DBs
NCBI-ProteinID: AGA08078
Position
complement(3354804..3356057)
Genome map
AA seq 417 aa AA seqDB search
MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPAAGTLSEIV
AQAGETVGLGALLGQIAEGAGAAAAAPAAAEKKPEPAAATAAPAAAAQPAAAAATQTSTS
MPPAPAAAKLIAENNLSADQIDGSGKRGQVLKGDVLAAVAKGISAPAAAEPAKVQARAPA
PAEDAAREERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMSAVMSLRSKYKDIFEKKH
GVKLGFMGFFTKAVTHALKELPAVNAEVDGTEIIYKNFCHVGVAVGTDKGLVVPVVRDAD
QMSIAEIEKEIGRLGKAARDGTLSMADMQGGTFTISNGGVYGSLMSSPILNAPQSGILGM
HKIQDRPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagaaatccgcgttcccacccttggcgaatccgtcagcgaagcgaccgtcggc
acctggttcaagaaggtcggcgacgcgatcaaggccgacgagccgatcctcgagctcgag
accgacaaggtgacgatcgaagttccggccccggccgccggcacgctcagcgaaatcgtc
gcgcaggcgggcgaaaccgtgggtctcggcgcgctgctcgggcagatcgccgagggcgcg
ggtgctgccgccgctgcgccggctgcggccgagaagaagcctgaacctgctgccgccacc
gctgctccggctgcggccgcacagccggccgccgctgccgcgacgcagacgtccacgtcg
atgccgccggccccggccgccgccaagctcatcgccgagaacaatctttccgccgatcag
atcgacggctcgggcaagcgcggccaggtgttgaagggtgacgtgctcgcggccgtcgcc
aagggcatttcggctccggctgcagccgaaccggccaaggtccaggcccgcgcgccggcg
ccggcggaagatgccgcccgcgaagagcgcgtgaagatgacccgcctgcgccagacgatc
gcccggcgtttgaaggacgcgcagaacaccgcggctatgctcaccacctataacgaggtg
gacatgagcgccgtcatgagcctgcgctcgaagtacaaggacatcttcgagaagaagcac
ggcgtgaagctcggcttcatgggcttcttcaccaaggccgtgacgcatgcgctgaaggag
ttgccggctgtcaacgccgaggtcgacggcaccgagatcatctacaagaacttctgccac
gtcggcgtcgccgtcggcaccgacaagggtctcgtcgtgccggtcgtgcgcgatgccgac
cagatgtcgatcgccgagatcgagaaggaaatcggccgtctcggaaaggcagcgcgcgac
ggtacgctgtccatggccgacatgcagggcggcaccttcaccatctccaacggcggcgtc
tacggttcgctgatgtcctcgccgatcctcaacgctccgcaatcgggcatcctcggcatg
cacaagatccaggaccgcccggtcgcgatcggcggtcaggtcgtcatccgcccgatgatg
tatctggcgctctcctacgatcaccgcatcgtcgacggcaaggaagcggtgaccttcctc
gtgcgcgtcaaggaaagcctcgaggatccggaacgcctggtgctggatctctag

DBGET integrated database retrieval system