KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr3208Help
Entry
C770_GR4Chr3208   CDS       T02405                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C770_GR4Chr3208
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C770_GR4Chr3208
   00650 Butanoate metabolism
    C770_GR4Chr3208
  Energy metabolism
   00190 Oxidative phosphorylation
    C770_GR4Chr3208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3374656..3375036)
Genome map
AA seq 126 aa AA seqDB search
MNMRTPLGKVRGLGSAKEGTDHFWRQRLTAVASIPLTIFFVVFLAHYAGAPHAELIAALS
NPFVAVTMGLMVVAGLVHMKIGMQVIIEDYVHGEGAKIALLMLNTFFTIAVGGLCLFAVL
KIAFAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcgcacacctctcggcaaggtccggggtctcggttcggcaaaggaaggcacg
gatcacttctggcggcagcgcctcacggccgtcgccagcattcctctcacgatcttcttc
gtcgtctttctcgcccattatgcgggcgcaccgcatgcggaactgatcgcggccctttcg
aacccgttcgtggcggtgaccatgggtctgatggtcgtcgccggcctcgttcacatgaag
atcggcatgcaggtcatcatcgaggactacgtccatggggagggcgccaagatagcgctt
ctcatgctcaacacattcttcacgatcgcggtcggcgggctctgtcttttcgccgtcctg
aagatcgcatttgcagggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system