KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr3208Help
Entry
C770_GR4Chr3208   CDS       T02405                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00020  Citrate cycle (TCA cycle)
smeg00190  Oxidative phosphorylation
smeg00650  Butanoate metabolism
smeg01100  Metabolic pathways
smeg01110  Biosynthesis of secondary metabolites
smeg01120  Microbial metabolism in diverse environments
smeg01130  Biosynthesis of antibiotics
smeg01200  Carbon metabolism
Module
smeg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smeg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smeg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C770_GR4Chr3208
   00650 Butanoate metabolism
    C770_GR4Chr3208
  Energy metabolism
   00190 Oxidative phosphorylation
    C770_GR4Chr3208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AGA08097
Position
complement(3376575..3376955)
Genome map
AA seq 126 aa AA seqDB search
MNMRTPLGKVRGLGSAKEGTDHFWRQRLTAVASIPLTIFFVVFLAHYAGAPHAELIAALS
NPFVAVTMGLMVVAGLVHMKIGMQVIIEDYVHGEGAKIALLMLNTFFTIAVGGLCLFAVL
KIAFAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcgcacacctctcggcaaggtccggggtctcggttcggcaaaggaaggcacg
gatcacttctggcggcagcgcctcacggccgtcgccagcattcctctcacgatcttcttc
gtcgtctttctcgcccattatgcgggcgcaccgcatgcggaactgatcgcggccctttcg
aacccgttcgtggcggtgaccatgggtctgatggtcgtcgccggcctcgttcacatgaag
atcggcatgcaggtcatcatcgaggactacgtccatggggagggcgccaagatagcgctt
ctcatgctcaacacattcttcacgatcgcggtcggcgggctctgtcttttcgccgtcctg
aagatcgcatttgcagggtaa

DBGET integrated database retrieval system