KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr3218Help
Entry
C770_GR4Chr3218   CDS       T02405                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00860  Porphyrin and chlorophyll metabolism
smeg01100  Metabolic pathways
smeg01110  Biosynthesis of secondary metabolites
smeg01120  Microbial metabolism in diverse environments
Module
smeg_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C770_GR4Chr3218
Enzymes [BR:smeg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     C770_GR4Chr3218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AGA08107
Position
3384864..3385571
Genome map
AA seq 235 aa AA seqDB search
MRVLVTRPRPAAERTAARLSAMGHEAVILPLMQAQHLAGAARAALSEPHQAIAVSSGEAV
RVLGALGPALEPHLATPLFAVGEATARAAGDLGFTDVRIGPGTGEGLAETVAALLPPGET
LVYLAGSPRTDGFERALHQRRIEHRTAECYRMAPVHYPAETLPGLLRAGPFDAVMLYSRE
SARRLDAALRESGLEPADLASRFLCLSWPIRETLPDGLPCGVAAVPDEENLLRLL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctcgtgacccggccacgcccggccgccgaaaggacggcggcaaggctcagc
gccatgggtcacgaagcggtcatcctgccgcttatgcaggcgcagcatctcgccggcgcg
gcccgggcagcattgagtgagccccaccaggcgatcgccgtcagcagtggggaggcggtc
cgcgtcctcggcgcgctcggaccggcgcttgagccacaccttgcaactccgctctttgca
gtcggcgaagcgacggcgcgcgctgcgggcgatctcggatttaccgatgtccgcatcgga
ccgggaaccggcgaaggactcgccgagacggtggctgcccttctcccccccggcgaaacg
ctggtctatctcgccggttcaccgcgaaccgacggtttcgaacgggcattgcaccaacgg
cggatcgagcacaggaccgccgaatgctaccggatggcgccggtccactatcctgcggag
acgctgcccggactcctccgcgcgggccccttcgatgcggtcatgctctattcccgcgag
agcgcgcggcgcctggacgcagcattgcgggagagcgggcttgaacccgcggacctcgcc
tcgcgctttctctgcctgagctggccgataagagagaccctgccggacggtctaccctgc
ggggtcgcggcggtgccagacgaggaaaatctcttgcggcttctttga

DBGET integrated database retrieval system