KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr3218Help
Entry
C770_GR4Chr3218   CDS       T02405                                 

Definition
Uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C770_GR4Chr3218
Enzymes [BR:smeg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     C770_GR4Chr3218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3382945..3383652
Genome map
AA seq 235 aa AA seqDB search
MRVLVTRPRPAAERTAARLSAMGHEAVILPLMQAQHLAGAARAALSEPHQAIAVSSGEAV
RVLGALGPALEPHLATPLFAVGEATARAAGDLGFTDVRIGPGTGEGLAETVAALLPPGET
LVYLAGSPRTDGFERALHQRRIEHRTAECYRMAPVHYPAETLPGLLRAGPFDAVMLYSRE
SARRLDAALRESGLEPADLASRFLCLSWPIRETLPDGLPCGVAAVPDEENLLRLL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctcgtgacccggccacgcccggccgccgaaaggacggcggcaaggctcagc
gccatgggtcacgaagcggtcatcctgccgcttatgcaggcgcagcatctcgccggcgcg
gcccgggcagcattgagtgagccccaccaggcgatcgccgtcagcagtggggaggcggtc
cgcgtcctcggcgcgctcggaccggcgcttgagccacaccttgcaactccgctctttgca
gtcggcgaagcgacggcgcgcgctgcgggcgatctcggatttaccgatgtccgcatcgga
ccgggaaccggcgaaggactcgccgagacggtggctgcccttctcccccccggcgaaacg
ctggtctatctcgccggttcaccgcgaaccgacggtttcgaacgggcattgcaccaacgg
cggatcgagcacaggaccgccgaatgctaccggatggcgccggtccactatcctgcggag
acgctgcccggactcctccgcgcgggccccttcgatgcggtcatgctctattcccgcgag
agcgcgcggcgcctggacgcagcattgcgggagagcgggcttgaacccgcggacctcgcc
tcgcgctttctctgcctgagctggccgataagagagaccctgccggacggtctaccctgc
ggggtcgcggcggtgccagacgaggaaaatctcttgcggcttctttga

DBGET integrated database retrieval system