KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr3242Help
Entry
C770_GR4Chr3242   CDS       T02405                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smeg01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:smeg00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3403424..3404605
Genome map
AA seq 393 aa AA seqDB search
MTKARKALENYRRVVIKIGSALLVDRRTGLKKSWLDALCADIAALRAKGVEVLVVSSGAI
ALGRTVLDLPAGALKLEESQAAAAVGQIVLARAWSESLSTHAIVAGQILLTLGDTEERRR
YLNARATIGQLLKLGSVPIINENDTVATTEIRYGDNDRLAARVATMVGADLLVLLSDIDG
LYTAPPHLDPNARFLETVAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATTAGCAMII
ASGKPDHPLAAIEAGARSSWFAPSGSPVTARKTWIAGQLLPAGSLSIDAGAETALRSGKS
LLPAGVRQVTGSFSRGDTIAIIGASGREIARGLAGYDADEARQIAGKKSAEIAAILGYAG
RTAMVHRDDLVMTAPSGARLVEESDEGKGKLHA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcccgcaaagcgctcgagaattaccgccgggtcgtcatcaagatcggctcg
gcactcctcgtcgaccgcaggaccgggctgaagaagagctggctcgacgcgctctgcgcc
gacattgcggccctcagggccaagggcgtggaagtgctcgtcgtctcctcgggagcgatt
gcgcttggacgcacggtgctcgacctgccggcgggtgcgctgaagctcgaagagagccag
gcggccgccgccgtcggccagatcgtgctggcgcgtgcctggtcggagagcctctcgacc
catgcgatcgtcgccggccagatcctcctgacgctgggcgacaccgaggagcgccggcgc
tacctcaatgcccgcgcgacgatcggtcagcttctgaagctcggctcggtgccgatcatc
aacgagaacgacacggtcgcgaccacagaaatccgctatggcgacaacgaccggctggca
gcgagggtcgcgaccatggtcggcgccgatctcctggtcctgctctcggatatcgacggg
ctctataccgcgccgccgcatctcgatccgaacgcccgtttcctcgaaacggtcgccgaa
atcacgcccgaaatcgaggcgatggcgggcggcgctgcctccgagctttcgcgcggcggc
atgcgcaccaagatcgacgccggcaagatcgcaaccactgccggctgcgcgatgatcatc
gcctccggcaagccggatcatccgctggccgcgatcgaggcgggcgcgcgctcgtcctgg
ttcgcgccatcaggctctccggtgaccgcccgcaagacctggatcgccggacagctcctg
ccggccggttcgctctcgatcgatgccggagcggaaacggcgctgcgttccggcaagagc
ctgctgccggccggcgtccggcaggtgacgggaagcttcagccgcggcgatacgattgcg
ataatcggcgcttccggccgcgagatcgcccgcggtcttgccggctacgatgccgacgag
gcgcgccagatcgccggcaagaagtcggccgagatcgccgccatcctcggctatgccggc
cgcaccgccatggtgcatcgcgacgatctggtcatgacggctccatcgggcgcgcgcctt
gtagaggaaagcgacgagggaaagggcaagctccatgcttga

DBGET integrated database retrieval system