KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr3242Help
Entry
C770_GR4Chr3242   CDS       T02405                                 

Definition
(GenBank) glutamate 5-kinase (EC:2.7.2.11)
  KO
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C770_GR4Chr3242
  Amino acid metabolism
   00330 Arginine and proline metabolism
    C770_GR4Chr3242
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    C770_GR4Chr3242
Enzymes [BR:smeg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     C770_GR4Chr3242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3405343..3406524
Genome map
AA seq 393 aa AA seqDB search
MTKARKALENYRRVVIKIGSALLVDRRTGLKKSWLDALCADIAALRAKGVEVLVVSSGAI
ALGRTVLDLPAGALKLEESQAAAAVGQIVLARAWSESLSTHAIVAGQILLTLGDTEERRR
YLNARATIGQLLKLGSVPIINENDTVATTEIRYGDNDRLAARVATMVGADLLVLLSDIDG
LYTAPPHLDPNARFLETVAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATTAGCAMII
ASGKPDHPLAAIEAGARSSWFAPSGSPVTARKTWIAGQLLPAGSLSIDAGAETALRSGKS
LLPAGVRQVTGSFSRGDTIAIIGASGREIARGLAGYDADEARQIAGKKSAEIAAILGYAG
RTAMVHRDDLVMTAPSGARLVEESDEGKGKLHA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcccgcaaagcgctcgagaattaccgccgggtcgtcatcaagatcggctcg
gcactcctcgtcgaccgcaggaccgggctgaagaagagctggctcgacgcgctctgcgcc
gacattgcggccctcagggccaagggcgtggaagtgctcgtcgtctcctcgggagcgatt
gcgcttggacgcacggtgctcgacctgccggcgggtgcgctgaagctcgaagagagccag
gcggccgccgccgtcggccagatcgtgctggcgcgtgcctggtcggagagcctctcgacc
catgcgatcgtcgccggccagatcctcctgacgctgggcgacaccgaggagcgccggcgc
tacctcaatgcccgcgcgacgatcggtcagcttctgaagctcggctcggtgccgatcatc
aacgagaacgacacggtcgcgaccacagaaatccgctatggcgacaacgaccggctggca
gcgagggtcgcgaccatggtcggcgccgatctcctggtcctgctctcggatatcgacggg
ctctataccgcgccgccgcatctcgatccgaacgcccgtttcctcgaaacggtcgccgaa
atcacgcccgaaatcgaggcgatggcgggcggcgctgcctccgagctttcgcgcggcggc
atgcgcaccaagatcgacgccggcaagatcgcaaccactgccggctgcgcgatgatcatc
gcctccggcaagccggatcatccgctggccgcgatcgaggcgggcgcgcgctcgtcctgg
ttcgcgccatcaggctctccggtgaccgcccgcaagacctggatcgccggacagctcctg
ccggccggttcgctctcgatcgatgccggagcggaaacggcgctgcgttccggcaagagc
ctgctgccggccggcgtccggcaggtgacgggaagcttcagccgcggcgatacgattgcg
ataatcggcgcttccggccgcgagatcgcccgcggtcttgccggctacgatgccgacgag
gcgcgccagatcgccggcaagaagtcggccgagatcgccgccatcctcggctatgccggc
cgcaccgccatggtgcatcgcgacgatctggtcatgacggctccatcgggcgcgcgcctt
gtagaggaaagcgacgagggaaagggcaagctccatgcttga

DBGET integrated database retrieval system