KEGG   Sinorhizobium meliloti GR4: C770_GR4pA039Help
Entry
C770_GR4pA039     CDS       T02405                                 

Definition
(GenBank) Sugar kinase, ribokinase family
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C770_GR4pA039
Enzymes [BR:smeg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     C770_GR4pA039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AGA08351
Position
pRmeGR4a:44562..45437
Genome map
AA seq 291 aa AA seqDB search
MTVAAPSVVVFGSLHYDIIVKGPHRPRKGETVTGSAWYPKCGGKGGNQAVSAAKYGVKSA
MIGAVAEDSFGHALKVNLDAHGVDIRSVRTVSGEGSGMSVAIFDADGDYGAVIVSGSNLA
LSEEDVSTAAELFRSDAVLVLQNEVPDAANVLAAQAMKKAGGRVVLNAAPARLPSADLVA
LVDVVVVNAVEAEALAEVPEVNSLDTALVAARILGRHYPAAVVTAGGDGVAFVQDGGYEA
KIPAIKVKLVSTHGAGDEFIGALAAELARGATLERAVNSGNEAAARLVSSP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgcagccccttccgttgtcgtgttcggtagccttcattacgatatcatcgtg
aaaggcccgcaccgcccaaggaagggcgaaaccgtcacgggctccgcctggtatccgaag
tgcgggggcaagggcggcaaccaggcggtttccgcggcaaaatacggcgtaaagtcggcg
atgatcggcgccgtagctgaagattccttcggccatgccctgaaggtgaacctcgatgcg
catggggtggacattcgatcggtgcggacggtctccggcgaagggtccggcatgagtgtt
gcgatcttcgacgcggacggcgactatggcgcggtcatcgtttcaggcagcaatctcgcc
ctttccgaagaagacgtttccacagccgcggaattgttccggagcgatgccgtcctggtg
ctgcagaatgaggtgccggatgcggcgaatgtgcttgctgcgcaagcgatgaagaaggct
gggggccgggtcgtactcaacgcggcgccagcccgtttaccgtcagcagacctggtcgct
ctcgtcgatgttgtcgtggtcaatgcggtcgaggccgaggcgcttgccgaggtaccagag
gtgaattccctcgatacggctttggtcgccgcccgcattctgggccgccattatcccgcg
gccgttgttaccgcgggcggtgatggtgtggcttttgtccaggatggcggctatgaggcc
aagatccctgcgatcaaggtcaaactcgtcagtacccacggcgccggcgacgagttcatc
ggcgcgcttgcagcagaactggcgcggggcgcgacgctggagcgggcggtgaatagcggc
aacgaagccgctgcccgcctggtcagttcaccttag

DBGET integrated database retrieval system