KEGG   Sinorhizobium meliloti GR4: C770_GR4pC1240Help
Entry
C770_GR4pC1240    CDS       T02405                                 

Definition
(GenBank) Endoglucanase Y (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
smeg  Sinorhizobium meliloti GR4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4c:complement(1214341..1215375)
Genome map
AA seq 344 aa AA seqDB search
MKPLVVLMLLLLASPMHAQVSATVDETAWQKYKARFLDPGGRIIDDANGDVSHSEGQGYG
LLLAFLAGNRADFELIWSFTRRELLLRDDGLAAWKWSPAETPHVADTNNATDGDILIAYA
LARAGNFWDRKDYTRAATALAEAILEKTVVEHAGLTLLLPGAQGFSAADRADGPVINPSY
WVFEAFPVLEQLVPSPSWKTVTADGEAILKKLEFGPKEMPADWISARTVLKPAEGFPPEF
GYNALRIPLYLVRSGRTDSELLSRIYRGMSNEEGAVLLSDVESGAVKETLTDPGYRIVNH
ILACVLQGTKLPDDVKTFDPTQYYPSTLHLLGLSFVEEMRPECL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaagccactcgtcgtgctaatgctcctgctgctagcttctccaatgcatgcccaggtg
tcagcgacggtggacgagacggcgtggcaaaagtacaaggcgcgatttctagatccgggc
ggtcggattatcgacgacgccaacggtgatgtcagccatagcgagggccagggttatggc
cttctgttggcctttctcgcgggcaaccgggccgactttgaactcatctggtctttcacg
cgccgcgagctcctcctgcgcgacgacggccttgcggcctggaaatggagcccggccgag
acgcctcatgttgccgatacgaacaatgcaacagacggcgacattttgatcgcctacgcc
ctggcgcgcgcagggaatttctgggatcgcaaggactacacgcgtgcggctaccgcgttg
gcagaggcgattctcgagaaaactgtcgtcgaacatgcggggctgacattgctcttgccg
ggagcgcagggattttctgcggccgatcgggccgacgggccggtcattaacccgtcgtac
tgggtgttcgaagcttttccagttctcgagcaattggttccttctccttcctggaagacg
gtaaccgcagacggtgaagctattctcaagaaattggagttcgggccaaaagagatgccg
gccgactggattagcgcacgaaccgtgctcaagccggcggagggcttcccgcccgaattc
ggctacaacgcgttgcgcatcccgctttatcttgttcgctcgggaaggactgacagtgag
ctcctttcgcggatctaccgcggcatgtctaacgaggaaggcgccgttctgctcagcgat
gtcgagagcggtgccgtgaaggagaccctcaccgatccaggttatcgaattgttaaccat
atcctggcctgtgtcctccaagggacgaagctccccgacgacgtgaagacgtttgatccg
acccaatactacccctcgacattgcacctgctgggcttgtctttcgtggaggaaatgcgt
ccggagtgcttatga

DBGET integrated database retrieval system