KEGG   Sinorhizobium meliloti GR4: C770_GR4pC1240Help
Entry
C770_GR4pC1240    CDS       T02405                                 

Definition
Endoglucanase Y (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C770_GR4pC1240
Enzymes [BR:smeg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     C770_GR4pC1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRmeGR4c:complement(1214290..1215324)
Genome map
AA seq 344 aa AA seqDB search
MKPLVVLMLLLLASPMHAQVSATVDETAWQKYKARFLDPGGRIIDDANGDVSHSEGQGYG
LLLAFLAGNRADFELIWSFTRRELLLRDDGLAAWKWSPAETPHVADTNNATDGDILIAYA
LARAGNFWDRKDYTRAATALAEAILEKTVVEHAGLTLLLPGAQGFSAADRADGPVINPSY
WVFEAFPVLEQLVPSPSWKTVTADGEAILKKLEFGPKEMPADWISARTVLKPAEGFPPEF
GYNALRIPLYLVRSGRTDSELLSRIYRGMSNEEGAVLLSDVESGAVKETLTDPGYRIVNH
ILACVLQGTKLPDDVKTFDPTQYYPSTLHLLGLSFVEEMRPECL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaagccactcgtcgtgctaatgctcctgctgctagcttctccaatgcatgcccaggtg
tcagcgacggtggacgagacggcgtggcaaaagtacaaggcgcgatttctagatccgggc
ggtcggattatcgacgacgccaacggtgatgtcagccatagcgagggccagggttatggc
cttctgttggcctttctcgcgggcaaccgggccgactttgaactcatctggtctttcacg
cgccgcgagctcctcctgcgcgacgacggccttgcggcctggaaatggagcccggccgag
acgcctcatgttgccgatacgaacaatgcaacagacggcgacattttgatcgcctacgcc
ctggcgcgcgcagggaatttctgggatcgcaaggactacacgcgtgcggctaccgcgttg
gcagaggcgattctcgagaaaactgtcgtcgaacatgcggggctgacattgctcttgccg
ggagcgcagggattttctgcggccgatcgggccgacgggccggtcattaacccgtcgtac
tgggtgttcgaagcttttccagttctcgagcaattggttccttctccttcctggaagacg
gtaaccgcagacggtgaagctattctcaagaaattggagttcgggccaaaagagatgccg
gccgactggattagcgcacgaaccgtgctcaagccggcggagggcttcccgcccgaattc
ggctacaacgcgttgcgcatcccgctttatcttgttcgctcgggaaggactgacagtgag
ctcctttcgcggatctaccgcggcatgtctaacgaggaaggcgccgttctgctcagcgat
gtcgagagcggtgccgtgaaggagaccctcaccgatccaggttatcgaattgttaaccat
atcctggcctgtgtcctccaagggacgaagctccccgacgacgtgaagacgtttgatccg
acccaatactacccctcgacattgcacctgctgggcttgtctttcgtggaggaaatgcgt
ccggagtgcttatga

DBGET integrated database retrieval system