KEGG   Sinorhizobium meliloti GR4: C770_GR4pD0040Help
Entry
C770_GR4pD0040    CDS       T02405                                 

Definition
ATP-dependent DNA ligase (EC:6.5.1.1)
Organism
smeg  Sinorhizobium meliloti GR4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRmeGR4d:complement(45665..46732)
Genome map
AA seq 355 aa AA seqDB search
MASSAHGKPTKKAAPSSAAKKAGGFPLPVTTAPMEARSATELPGGDAWQYEPKWDGFRCL
AFKSGDEVDIRAKSGKPLGRFFPEIVALLRRLEPDMFVLDGELVIEVDGRLSFDALQMRL
HPAASRVQKLSQETPAKLILFDMLAGTDGTILTGEPLQTRRACLEAFAKKNAVAGMLESS
PFTLDIEEAERWLTSWEACATDGVVAKRRDGVYECGERAMVKVKRLKTADCVVGGFRYES
DSSLVGSLLLGLYDTEGLLNHVGFTATISDKERPALTNQLEALREPPGFTGKAPGGPSRW
SSERSGEWEPVRPELVVEVRFDHVSNRRFRHGTKLMRWRPDKDPRQCTYQQIMPS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtccgcacatggaaagccgacgaagaaggccgctccgtcaagcgcggcaaag
aaggcgggcggctttcccctgcccgtcaccacggcgccgatggaggcccgatccgcgacc
gagcttccgggcggcgacgcatggcagtatgagccgaagtgggacggctttcgctgcctt
gcgttcaagtccggcgacgaagtcgatataagggcgaaatccggcaagccgctcgggcgc
ttcttcccggagatcgtcgccctcttgcgccggctggagccggacatgttcgtcctcgac
ggcgaactggtgatcgaggtcgacgggcgcctctccttcgacgccctgcagatgcgcctg
catccggcggcaagtcgcgtgcagaagctctcgcaggagacgccggccaagctcatcctg
ttcgacatgctggccggcacggacggaacgatcctgaccggtgaacccctccagacccgc
cgcgcctgcctcgaagccttcgccaagaagaacgccgttgctgggatgctggagtcttcg
cccttcacgctcgacatcgaggaggccgagcggtggctcacctcatgggaggcgtgtgca
accgacggggtcgtcgcaaagcggcgcgacggcgtatacgaatgcggcgaaagggcaatg
gtgaaggtcaaacggctgaagacggccgattgcgtcgtcggcggcttccgttacgagagc
gacagctctttggtgggctcgcttctgctcggcctttacgacaccgagggactgctgaac
catgtgggctttaccgcgacgatctcggacaaggagcggcccgccttgaccaaccagctc
gaagcattgcgggagccgccgggcttcaccggcaaagcgccgggcgggcccagccgctgg
agcagcgagcgcagcggcgaatgggagccggttcgcccggaactggtcgtcgaagtccgg
ttcgaccatgttagcaaccggcgcttccgtcacggtacgaagctcatgcgctggcggccg
gacaaggacccgcgccaatgtacctatcagcagatcatgccgtcgtga

DBGET integrated database retrieval system