KEGG   Sinorhizobium meliloti GR4: C770_GR4pD0060Help
Entry
C770_GR4pD0060    CDS       T02405                                 

Definition
Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smeg00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:smeg00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:smeg00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRmeGR4d:69916..71289
Genome map
AA seq 457 aa AA seqDB search
MTRQPRITFIGAGSTVFMKNIIGDILQRPALSAATIALMDVNPERLAESEIVAGKLARTL
GADARIETHSNQRKALEGADFVVVAFQIGGYEPCTVTDFEVPKKYGLRQTIADTLGVGGI
MRGLRTVPHLWKICEDMLEVCPEAILLQYVNPMAINTWAIAEKYPAIKQVGLCHSVQGTA
FELARDLDIPLDEIRYRAAGINHMAFYLKFEHRQKDGSYRDLYPDLIRGYREGRFPKPSH
WNPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKDGRPDLIEKFGIPLDEYPKRCVE
QIERWKGQAAAFKEAKTIEVAESREYASSIMNSVWTGEPSVIYGNLRNNGCITSLPENCA
AEVPCLVDSSGIQPTYIGALPPQLTALIRTNINVQELAVQALVTENREHLYHAAMMDPHT
AAELDLDQIWSLVDDLLAAHRDWIPEWARVTKKVAAA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacgagacaacccaggattactttcatcggtgccggttccaccgttttcatgaaaaac
atcatcggcgacatattgcagcgcccggcgctttcggccgcgaccatcgccctgatggac
gtcaaccccgagcggctcgccgaaagcgagatcgtcgccggcaaactggcgcgcacactt
ggcgccgatgccaggatcgaaacccattcgaaccagcgcaaggctctggaaggagcggac
ttcgtcgtcgtcgccttccagatcggcggttacgagccctgcacggtcaccgacttcgaa
gtgcctaagaaatacgggctgcgtcagacgatcgccgacacgctgggcgtcggcggcatc
atgcgcgggctccgcaccgtgccgcatctctggaaaatctgcgaggacatgctcgaggtc
tgccccgaggcgatccttctgcaatatgtgaatcccatggcgataaacacctgggcgatc
gccgagaaatatccggcgatcaagcaggtgggcctctgccattcggtgcagggcacggcc
ttcgagcttgcccgggacctcgacattccactcgacgaaatccgctaccgcgccgccggc
atcaaccacatggcgttttatctcaagttcgagcaccgccagaaggacggcagctatcgc
gatctctatccggacctgatccgcggctaccgcgagggccgcttccccaagcccagccac
tggaacccgcgctgccccaacaaggtgcgctacgagatgctgacgcggctcggttatttc
gtcaccgagagctcggagcatttcgccgagtacacgccctacttcatcaaggacgggcgc
cccgatctgatcgagaaattcggcattccgctcgatgaatatccgaagcgctgcgtcgag
cagatcgagcgctggaaggggcaggcggccgccttcaaggaggcgaagacgatcgaagtc
gcggagagccgcgaatatgcctcctcgatcatgaattcggtctggaccggcgaaccttcg
gtcatctacggcaacctcaggaacaatggctgcatcacctcgctgccggaaaactgtgcg
gcggaagtgccctgcctcgtcgattcatccggcatccaaccgacctatatcggcgccctg
ccgccgcagctcacggccctgatccgcaccaacatcaacgtccaggaattggctgtccag
gcgctcgtcaccgagaaccgcgagcatctctatcacgcggcgatgatggatccgcatacc
gccgccgagctcgatctcgaccagatctggtcgctcgtggacgatctgctcgcggcgcac
cgcgactggatccccgaatgggcccgtgtgacgaagaaggtagcggccgcctga

DBGET integrated database retrieval system