KEGG   Sinorhizobium meliloti GR4: C770_GR4pD0060Help
Entry
C770_GR4pD0060    CDS       T02405                                 

Definition
(GenBank) Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00052  Galactose metabolism
smeg00561  Glycerolipid metabolism
smeg00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    C770_GR4pD0060
  Lipid metabolism
   00561 Glycerolipid metabolism
    C770_GR4pD0060
   00600 Sphingolipid metabolism
    C770_GR4pD0060
Enzymes [BR:smeg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     C770_GR4pD0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-ProteinID: AGA10186
Position
pRmeGR4d:69916..71289
Genome map
AA seq 457 aa AA seqDB search
MTRQPRITFIGAGSTVFMKNIIGDILQRPALSAATIALMDVNPERLAESEIVAGKLARTL
GADARIETHSNQRKALEGADFVVVAFQIGGYEPCTVTDFEVPKKYGLRQTIADTLGVGGI
MRGLRTVPHLWKICEDMLEVCPEAILLQYVNPMAINTWAIAEKYPAIKQVGLCHSVQGTA
FELARDLDIPLDEIRYRAAGINHMAFYLKFEHRQKDGSYRDLYPDLIRGYREGRFPKPSH
WNPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKDGRPDLIEKFGIPLDEYPKRCVE
QIERWKGQAAAFKEAKTIEVAESREYASSIMNSVWTGEPSVIYGNLRNNGCITSLPENCA
AEVPCLVDSSGIQPTYIGALPPQLTALIRTNINVQELAVQALVTENREHLYHAAMMDPHT
AAELDLDQIWSLVDDLLAAHRDWIPEWARVTKKVAAA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacgagacaacccaggattactttcatcggtgccggttccaccgttttcatgaaaaac
atcatcggcgacatattgcagcgcccggcgctttcggccgcgaccatcgccctgatggac
gtcaaccccgagcggctcgccgaaagcgagatcgtcgccggcaaactggcgcgcacactt
ggcgccgatgccaggatcgaaacccattcgaaccagcgcaaggctctggaaggagcggac
ttcgtcgtcgtcgccttccagatcggcggttacgagccctgcacggtcaccgacttcgaa
gtgcctaagaaatacgggctgcgtcagacgatcgccgacacgctgggcgtcggcggcatc
atgcgcgggctccgcaccgtgccgcatctctggaaaatctgcgaggacatgctcgaggtc
tgccccgaggcgatccttctgcaatatgtgaatcccatggcgataaacacctgggcgatc
gccgagaaatatccggcgatcaagcaggtgggcctctgccattcggtgcagggcacggcc
ttcgagcttgcccgggacctcgacattccactcgacgaaatccgctaccgcgccgccggc
atcaaccacatggcgttttatctcaagttcgagcaccgccagaaggacggcagctatcgc
gatctctatccggacctgatccgcggctaccgcgagggccgcttccccaagcccagccac
tggaacccgcgctgccccaacaaggtgcgctacgagatgctgacgcggctcggttatttc
gtcaccgagagctcggagcatttcgccgagtacacgccctacttcatcaaggacgggcgc
cccgatctgatcgagaaattcggcattccgctcgatgaatatccgaagcgctgcgtcgag
cagatcgagcgctggaaggggcaggcggccgccttcaaggaggcgaagacgatcgaagtc
gcggagagccgcgaatatgcctcctcgatcatgaattcggtctggaccggcgaaccttcg
gtcatctacggcaacctcaggaacaatggctgcatcacctcgctgccggaaaactgtgcg
gcggaagtgccctgcctcgtcgattcatccggcatccaaccgacctatatcggcgccctg
ccgccgcagctcacggccctgatccgcaccaacatcaacgtccaggaattggctgtccag
gcgctcgtcaccgagaaccgcgagcatctctatcacgcggcgatgatggatccgcatacc
gccgccgagctcgatctcgaccagatctggtcgctcgtggacgatctgctcgcggcgcac
cgcgactggatccccgaatgggcccgtgtgacgaagaaggtagcggccgcctga

DBGET integrated database retrieval system