KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1402Help
Entry
C770_GR4pD1402    CDS       T02405                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione synthase
  KO
K03396  
S-(hydroxymethyl)glutathione synthase [EC:4.4.1.22]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    C770_GR4pD1402
Enzymes [BR:smeg01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.22  S-(hydroxymethyl)glutathione synthase
     C770_GR4pD1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:complement(1542699..1543268)
Genome map
AA seq 189 aa AA seqDB search
MLKLHPSIDNGFPPASPGFAGGTLKCKCASNPVTVRIGSQTAHNHACGCTKCWKPEGAIF
AQIAVVGRDNVNVTSGAEKLQVVDPSATIQRYACRDCGTHMYGRIENTKHPFYGLDFVHT
ELSDETGWSPPEFAAFVSSIIESGVNPESMPEIRARLTELGLQPYDCLSPPLMDAIATHI
AKQTGALPA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagctacatccgtccatcgacaacggcttcccgcctgccagtccgggctttgcc
ggcggtacgctgaaatgcaaatgcgcctcaaatccggtgaccgtgcggatcggctcgcag
acggcgcacaaccacgcctgcggctgcaccaagtgctggaaacccgagggtgccatcttc
gcgcagatcgccgtcgtcggccgcgacaacgtgaacgtcacctcaggtgcggaaaaactg
caggtcgtcgatccgagcgcgacgatccagcgttacgcctgccgcgattgcggcacgcac
atgtatggcaggatcgaaaacaccaagcatcccttctacggccttgacttcgtccatacc
gaactcagcgacgaaacgggctggtcgccgcccgaattcgcagccttcgtttcttcgatc
atcgaaagcggtgtgaacccggagagcatgccggagatacgcgcaaggctgaccgagctc
ggcctgcagccctatgattgtctgtctccgccgctgatggacgcgatcgccacgcatatc
gccaaacagaccggcgccctgccggcctga

DBGET integrated database retrieval system