KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1405Help
Entry
C770_GR4pD1405    CDS       T02405                                 

Definition
(GenBank) ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component
  KO
K02049  
NitT/TauT family transport system ATP-binding protein
Organism
smeg  Sinorhizobium meliloti GR4
Module
NitT/TauT family transport system
Brite
Transporters [BR:smeg02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    C770_GR4pD1405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:complement(1544902..1545525)
Genome map
AA seq 207 aa AA seqDB search
MIRIDVRRKAFGEEEVLRDIRFEMEIGETVAILGPSGVGKSTLLRLVAGIDTAFEGEITR
PENIAMVFQEPVLLPWRSVIENLTLVHPQLGAQAALSALERTGIADRAGLFPGQLSLGQQ
RRLALARAFAGRPELLVLDEPYVSLDPAMAEDMLALTEALIAETAPAVILVTHSEAEARR
LARRCLRLAGKPATIIEEFAAAPGRAS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaggatcgatgtcagacgaaaggcattcggcgaagaggaggtcctgcgcgacatc
cgcttcgagatggagatcggcgagacggtcgccattctcggtccgtcgggcgtcggcaag
tcgacgctgcttcgtctcgtcgccggcatcgacaccgctttcgagggcgagatcacccgg
ccggaaaacattgccatggttttccaggagcctgtccttctgccgtggagaagcgtcatc
gagaacctgacattggtgcatccgcaactcggggcgcaagctgcactctcagcgctggag
cggaccggcattgccgacagggccgggctctttcccggccagctgtcgctcggccagcag
cggcggctggcgctggcgcgggcctttgccggccggccggagcttctcgtcctggacgag
ccctatgtgtcgctcgatcctgcgatggccgaggacatgctggccctgaccgaggcgctg
atcgcggaaacggcccctgccgtcattctcgtgacccattcggaggccgaggcgcggcgg
ctcgcccggcgctgcctccgccttgccgggaaaccggcgacgattatagaagagtttgcg
gcggcgccgggaagggcatcatga

DBGET integrated database retrieval system