KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1418Help
Entry
C770_GR4pD1418    CDS       T02405                                 

Definition
(GenBank) S-formylglutathione hydrolase
  KO
K01070  
S-formylglutathione hydrolase [EC:3.1.2.12]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    C770_GR4pD1418
Enzymes [BR:smeg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.12  S-formylglutathione hydrolase
     C770_GR4pD1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:complement(1555160..1555990)
Genome map
AA seq 276 aa AA seqDB search
MELVTQSQCFGGTQSVYRHASEVCGVEMTFGLYMPPQARTRSVPLLWYLSGLTCTHENAM
IKAGLQRHAAEQGLALVFPDTSPRGEGVADDEAYDLGQGAGFYVNATQKPWSPHYRMYDY
IVTELPALLQEQLPLNGVNGITGHSMGGHGALTIAFRNPELFRSVSAFAPIVNPTRSDWG
RKQFSAYLGDDEADWGSYDACLLLGELGWHGDILIDQGAADQFLDELQPEAMARLLAERR
QAGVVRLQAGYDHSYYFVASFGEDHVRWHAERLNAA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggaactcgtaacgcaaagccaatgtttcggcggaacccagtcggtctaccgccacgcc
tccgaggtttgcggcgtcgagatgacattcggcctctacatgccgccacaggcgcggacg
cgttcggtaccgctcctgtggtatctctcgggcctgacatgcacgcatgagaacgccatg
atcaaggcgggcctgcagcggcacgcggccgagcaggggctggcgctggttttccccgac
acctcgccgcgcggcgagggcgtggctgacgacgaggcttatgatctcggtcagggtgcg
ggcttctatgtcaatgcgacgcagaagccctggtcgccgcactatcgcatgtatgattat
atcgtcaccgaattgcccgcccttctgcaggagcagttgccgctcaacggcgtcaacggc
attaccgggcactcgatgggcggccacggcgcgctgacgatcgccttccgcaatccggaa
ttgttccgctccgtttcggccttcgcgccgatcgtgaatccgacccggtcggactggggg
cgcaagcagttctcggcctatctcggcgacgacgaggccgactggggcagctatgacgcc
tgcctgcttctcggcgagctcggctggcatggcgatatcctgatcgatcagggcgctgcg
gaccagtttctggacgagctgcagcccgaggcgatggcccgcttgctggcggagcggcgg
caggccggcgtggtccggctgcaggcgggttacgatcacagctattatttcgtggcgagc
ttcggcgaggaccacgtgcgctggcatgcagagcggctgaacgccgcgtaa

DBGET integrated database retrieval system