KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1435Help
Entry
C770_GR4pD1435    CDS       T02405                                 

Definition
(GenBank) ABC-type Fe3+ transport system, permease component
  KO
K02011  
iron(III) transport system permease protein
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
ABC transporters
Module
Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    C770_GR4pD1435
Transporters [BR:smeg02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190] [OT]
    C770_GR4pD1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:complement(1571435..1573285)
Genome map
AA seq 616 aa AA seqDB search
MALLSEPAKAAAAETRSAAPSAWQAWRYRLKVALREPTTLIGVLTALLFTYLIVVPIISI
VLDAVRVQFGHERRLSKDVGDLTLYYLDRALFSPVSADLFWRPLFNTLSVAVGAISLSLL
VGTVLAWLISRTDMFGRRWFATALIVPYMLPAWTFALAWTTLFKNRTVGGQPGWLEATGL
TPPDWLAYGRFPITIILALHYTPFVILLFGSALRRFDSQLEDSARILGAKRHQVALQIIL
PLMRPALLSSMVLIFAKCLGEFGVPYVLGLPVKFEVLSTSLFRSIASRQTGVAGVIAGSI
MLIGIITLWIDARLVREARRFVTIGSKGSMNRQSRLGRMRLPAAGFAATVFLLSVGLPLL
TLLLSTVMKMPARFTLDNFTLDYWIGRDLDTIALKTGILLSPDLWAAARNTLTIVGIASV
TSGILGLLVGYVVIRTPVRLLSVYLRQVTFLPYLVPGIAFAAAYLSLFAVPRGPLPALYG
TVVILVLALIADQMPYASRAGISAMTQLGKDPEEAAQVAGAGWLRRMISIVIPIQKGSLV
TGVLLPFISGIKGLSLFVILAVPSTDVLTTYSLRLVDYHYTQAANAVVLIIAAIAYCGTL
IAQKLTRTNLAEGLGS
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggctcttctaagtgaaccggcaaaggcggcggcggctgaaacccggtctgccgcgcct
tcggcctggcaggcatggcgctatcggctgaaggttgccctgcgtgaacccacgaccctg
atcggtgttctgacggcgctgctgttcacgtacctgatcgtcgttccgatcatttccatc
gtgctcgacgccgttcgcgtgcagttcgggcacgagcggcgcctgagcaaggatgtcggc
gatctcacgctctattatctcgacagagcgctgttctcgcccgtgtcggcggacctgttc
tggcgcccgcttttcaacacgctctccgttgccgtgggcgccatatcgctctcgctgctg
gtcggcactgtgcttgcctggctcataagccgaacggacatgttcgggcgccgctggttc
gcgaccgcgctgatcgtgccctacatgctgccggcctggaccttcgcgctcgcctggacg
acgctcttcaagaaccgtacggtcggcggccagcccggatggctggaagcgacggggctg
acaccgcccgactggctcgcctatggccggtttccgatcaccatcatcctcgcgctgcac
tacacgcccttcgtcattctcctgttcggctcggcgctcaggcgcttcgattcccagctc
gaggattcggcacgcatcctcggtgccaagcgccaccaggtggcgctgcagatcatcctg
cccctgatgcgcccggcattgctctcctcgatggtgctcatcttcgccaagtgcctggga
gaattcggcgtgccctatgtgcttggcctgccggtcaagttcgaagttctttcgacgtcg
ctcttccgcagcatcgcctcgcgccagacgggcgtcgccggggtaatcgccggctcgatc
atgctgataggcatcatcactctgtggatcgatgcgcggctggtgcgcgaggctcgccgg
ttcgtcacgattggttcgaaagggtcgatgaaccggcagagccggcttggccgcatgcgc
ctgccggcggcgggattcgccgccacggtctttctgttgagcgtgggcttgccactcctc
actttgttgctgtcgacggtcatgaagatgcctgcgaggttcacgctcgacaacttcacg
ctggactactggatcggtcgtgatctcgacacgattgccctgaagaccggcatcctcttg
agccccgacctctgggccgctgcaaggaacacgctgacgatcgtcgggatcgcctcggta
acctccggcattctcggcctgctggtcggctacgtggtcatccgcacgccggtgcgcctc
ctgtcggtctatcttcggcaagtgaccttcctgccttatctggtgcccggcatcgccttt
gctgctgcctatctgtccctgttcgcggttccccgcggcccattgccggcgctctatggc
acggtggtcatcctcgtgctggcgctcatcgccgaccagatgccctacgcctcgcgcgcc
ggcatctcggccatgacgcagctcggcaaggacccggaggaggcagcccaggtcgcggga
gccggctggctcaggcggatgatctcgatcgtcattccgatccagaagggctcgctcgtg
accggcgtgctgctgccgttcatctccgggatcaaggggctcagcttattcgtcatcctg
gcggtgccgagcacggatgtgctgaccacctattcgttgcggctggtcgactatcactac
acgcaggccgcgaacgccgtggtgctcatcatcgctgccatcgcctattgcggcacgctc
atcgcccagaagctgacccgcacaaatcttgcagaaggacttggaagctga

DBGET integrated database retrieval system