KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1440Help
Entry
C770_GR4pD1440    CDS       T02405                                 

Definition
(GenBank) Transposase-like protein, TnpA family
Organism
smeg  Sinorhizobium meliloti GR4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_Tn3 DUF4158
Motif
Other DBs
NCBI-ProteinID: AGA11543
Position
pRmeGR4d:1578499..1581549
Genome map
AA seq 1016 aa AA seqDB search
MLPDTEAMVVRHHSLDANDLAAINSARTPETRLGYALQLCCLRYPGRHLRRGELLPAVML
DHIAEQIGADAEVIAGFARRTPTRYDQLLAIKARFGFADLTKPMRATLRAWLEAEAVSLT
DGRVLLDKFLDELRARKIVIPGITVVERMAAEAMHAAETRIIADIDNSLDSATRGRLDVL
IAEKTHDRQSRFSWLREPTPRVASASLAGILDKIELVRGIGTPAVAIDRRYEPRMEQFAR
EGVRYTAQAFQQMGSARRHVILVATLREFEATLTDTAIGMFGSLIGRAHLRARKRLEQTV
AASADQGRDRLIRVAGVLEAVSKAARAGGDIAAAVAAVASLDTIDADAALLRRTTRPGRD
NAISEIGPKYRTFKRSGPRFLKAFAFEGRKGTAPLRAAMVILTELYGDWRTPLPDGVPLG
HIERRWQRYVITNGEVDRTHWELATYSALAGALAAGDIWVPSSRLHRSLETLLAPNADAV
PAQAADIPDPHVWLDARAAALDTALLGVLRGLPSGDPALFSGDRLRFPKEPRTDLAERDD
GRWFALNCYNLVPPTRIFLAALIAEATNLGLSRMAEVCGVASRRALLRMQTWHMREETFR
AALACLTDAIHAEPMASWFGEGWRASADGQAYYLGGAGEAGGQVNAHYGRDPIIKIYTTI
TDRYAPLHQTVIAGTAGEAIHALDGILGHESSANLSALHVDGGGVSDIVFAVMHLLGLEF
EPRIPRLSDRRLYAFEAPKRYGRLAPLFGHRLNRDLIVNHWSDIQRVIGAMRDRTVTPSL
ILKKLSAYRQQNSLAAAPREIGRIERTLFTLRWFQDPGLRQLVTGELNKGEARNSLARAV
AFNRLGRFRDRGLENQQTRAAALNLVTAAIILFNCRYLDRAVGELRKRGMTLDPTLLSQL
SPLGWDRINLTCDYVWSDNIELDADGLMQTGWRMRLSIRRPLSSRIGWATEATWALIRFR
SRSMSRCSELVCMLSSRPSRRRCRWHSADCFSSRRTSSFTSTRRRASSASPVAKTA
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcccgacaccgaggcgatggtcgttcgccatcacagtctggacgcaaacgacctt
gccgccatcaacagcgcccgcacacccgagacccggcttggctatgctttgcagctttgt
tgtctgcgttatccggggcgacatctccggcgtggtgaattgcttcccgccgtcatgctc
gatcatatcgccgagcagatcggggccgatgcagaagtgatcgccggtttcgcgcgacgc
acgccaacacgctacgatcagcttcttgcgatcaaggcgcgtttcgggttcgccgacctc
accaagccaatgcgcgcaacacttcgcgcgtggctggaagccgaagctgtcagcctgacc
gacgggcgcgtcttgttggataagttcctcgatgaactgcgcgcccgcaagatcgtcatt
cccggcatcaccgtggtcgagcgcatggcagccgaggcgatgcatgcagccgaaacccgg
atcatcgccgatatcgacaacagtctagattcggcaacccgtggccgactggacgtgctt
atcgccgagaaaacgcacgaccggcaaagccgattttcctggctacgggaacccaccccg
cgcgtcgcctcggcctcgctcgccggtattctcgacaagatcgaactggttcgcggcata
gggacgcccgccgtcgccatcgatagacgatacgaaccccgaatggagcaatttgcgcgc
gaaggcgtccgctacaccgcgcaggccttccagcagatggggtcggcgcggcggcatgtt
attcttgtggcgacgctgcgcgagttcgaggctacgttgaccgacacggcgatcggtatg
ttcggctcgctcatcgggcgggcgcatctgcgtgcccgcaaacggcttgagcagacggtt
gccgcctctgccgaccagggccgcgaccgactgatccgtgtcgccggcgtgcttgaggcg
gtcagcaaagccgcgcgcgccggcggcgatattgcagcagcggtcgcggcggtcgcctca
ctcgatacgatcgacgccgacgctgctcttctccggcgaaccacgaggccgggacgagat
aatgccatcagtgagatcgggccgaaatatcggacgttcaaacgatcgggaccacgtttc
ctgaaggcattcgcattcgaggggcgcaagggtaccgcgccgctccgcgcagcgatggtg
atcctgaccgaactctacggcgactggcgcacgccgctccctgacggcgtgccgctcggg
catatcgagcggcgctggcagcgctatgtcatcacgaacggcgaggtcgaccgaacccat
tgggagctggcgacctattccgcgttggccggcgcattggcggcgggcgacatctgggtg
ccgagctcccgactgcaccgctcactggaaacgctgctcgcaccgaacgcggacgcggtc
ccggcacaggccgccgatattcctgatcctcatgtgtggctcgatgcacgcgcggctgca
ctcgacaccgcgttactcggggtgttgcgaggtctgcccagcggcgatcccgcgctgttt
tccggcgaccgtcttcggttcccgaaagagccgaggaccgaccttgccgaacgcgacgat
ggcaggtggttcgccctgaactgctataatctcgtgccaccgacgcgcatcttcctcgcc
gcgctgatcgcggaagcgacgaaccttggcctttcccgtatggcggaggtctgcggcgtg
gcatcgcggcgtgcgctcctgcgaatgcagacctggcatatgcgcgaagagacgttccgc
gccgcgctcgcgtgtttgaccgatgccatacatgccgagccgatggcgtcgtggttcggc
gagggctggcgcgcctcggccgatggccaggcttattatctcggcggcgccggtgaggct
ggcggtcaggtcaacgcgcattacggccgcgatccgatcatcaaaatctacaccacaatc
accgaccgctacgcaccgctccaccaaaccgtgattgcgggcactgctggagaagcgatc
catgcgctcgatggcattctcggtcatgaaagcagcgccaatctttcggcgctgcacgtc
gatggcggcggggtctccgacatcgtgtttgcggtcatgcatctgctcgggctcgaattc
gagccccgaatcccgcgtctttccgatcgccgcctctatgccttcgaggcacccaagcgc
tacggtcgcctcgcaccgctgtttggacacaggctcaaccgcgatctgatcgttaatcac
tggtccgacattcagcgtgtcatcggggcgatgcgggaccgaaccgtcaccccgtcgctg
atcctgaaaaagctgtccgcctaccggcaacagaatagtcttgccgcggcaccgcgcgag
attggccgtatcgagcgcacgctgttcacgctgcgatggttccaggacccggggcttcgc
caactcgttaccggcgagctcaacaagggcgaagcgcgcaacagcctggcgcgggcggtc
gcgttcaatcggctcggccgctttcgggatcgcggtctcgaaaatcagcagacacgcgcc
gccgccctcaatctcgtgactgccgcgatcatcctgttcaattgccgctatctcgaccgc
gccgtgggcgaattgagaaaacgcggaatgacgctcgatcccacactgctttcgcagctt
tctcctttgggctgggaccggatcaacctcacctgtgattatgtctggtcagacaacatt
gaactcgacgctgatggcctcatgcagacgggctggcggatgcggctctcgatcaggagg
ccgctgtcgtcgaggatcgggtgggcgaccgaggcgacatgggcattgatccgcttcagg
tcgcgcagcatgtcgagatgcagcgaactcgtctgcatgctgtccagccgcccttcgcgc
aggcgctgcagatggcattccgccgattgcttctcgagccggcgcacctcttccttcacc
tccacgagacgccgcgccagctccgcgtcgccggtcgcgaaaacagcctga

DBGET integrated database retrieval system