KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1445Help
Entry
C770_GR4pD1445    CDS       T02405                                 

Definition
(GenBank) hypothetical protein
  KO
K22129  
D-threonate/D-erythronate kinase [EC:2.7.1.219 2.7.1.220]
Organism
smeg  Sinorhizobium meliloti GR4
Brite
Enzymes [BR:smeg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.219  D-threonate 4-kinase
     C770_GR4pD1445
    2.7.1.220  D-erythronate 4-kinase
     C770_GR4pD1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:1586560..1587591
Genome map
AA seq 343 aa AA seqDB search
MLVILADDLTGALDSAAPFAGRGLRTEVALALDSVDAALADAPDILVVNVKSREVSADEA
RKATSDVLKHIPQSARIFKKVDSRLKGNIEAELDATPFARAVVAPAIPDFGRIVVDGHVR
GFGVEAPIPVAERFGRHAGRTLIPDTMSRTDMLAALASAEAAGCDLMIGARGLADALAHL
MTDSETLPLIPLPRQPILIVVGSRDPITVEQVDVLRENHSTEYVPAAGGRVQQPSAPATG
TVTIIQATEGVTPLGPAEVSANLADSVVPAFTGGAATLLLTGGATAEAVLERMGVSRFRL
LGECVPGIALAFADGRYIITKSGGFGGPDTLSDIARQIMGEAR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgattctcgccgatgatctgacgggtgctcttgattcagctgccccgtttgcg
ggccgcggccttcgtacggaagtcgctctcgcgctggactccgtggatgctgcactggcg
gacgcaccggacattctcgtcgtcaacgtgaagtcccgcgaggtttccgcggatgaggcg
cgcaaggcgacatcagacgtcctgaagcacatccctcaaagtgcgcggattttcaagaaa
gtcgactcacggttgaagggcaatatcgaagctgagctcgacgccaccccttttgcccgc
gcggtcgtcgcgccggctatccccgatttcggccgcatcgtggtggacggccatgtccgg
gggttcggcgtggaagcgccgatcccggtcgccgaaaggtttggccgacatgcgggtcgg
acattgataccggatacgatgtctcgcacagacatgctcgccgccttggcaagcgccgag
gcggccggctgcgacctcatgatcggcgcgagagggcttgccgatgcacttgcccatcta
atgacggatagcgaaacgctgccgctgataccgctaccccggcaacctatactgatcgtc
gtcggatcgcgcgacccgatcacggtcgagcaggtcgacgtgctgcgggaaaaccattcc
accgaatatgtcccggcagccggaggcagggtgcagcagcccagcgcccccgcaaccggg
acggtgaccatcattcaggcgaccgagggcgtaacgccgctcggcccggccgaagtctcc
gccaacctggccgatagcgtcgttccggcgttcaccggcggggccgcgaccctgcttctt
acaggtggtgcgacagccgaggcagtgctggagaggatgggcgtttcccgattccgcctt
ctgggcgaatgcgtgcccgggatcgcgctggcctttgccgatggccgctatatcatcacc
aagtccggcggcttcggcgggccggacacgctgagcgacatcgcaaggcaaataatgggg
gaggcgagatag

DBGET integrated database retrieval system