KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1451Help
Entry
C770_GR4pD1451    CDS       T02405                                 

Definition
(GenBank) ABC-type dipeptide/oligopeptide/nickel transport systems, permease component
  KO
K02033  
peptide/nickel transport system permease protein
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Quorum sensing
Module
Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    C770_GR4pD1451
Transporters [BR:smeg02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    C770_GR4pD1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:1593682..1594596
Genome map
AA seq 304 aa AA seqDB search
MLRFIRQRALASLISLIGLIVMVFFLSRMTGDPAALFLPVEASAEMKEQFRELHGLNDPI
LVQFARYVGDVVTGDLGESLRKARPALDVVLEAFTWTLWLAVITMTLVTGAAIVVGSLGA
FRSAGFFDRLSSMVSLIGASVPDFWLAIVAIVIFSINFAILPTSGTGSVVHWILPIAVLF
VRPFGIIVQVVRGSMVSALSSAYVKTARAKGVKSGPIIFIHALRNAMLPVITVVGDQAAS
LLNGAVVVETIFGFPGVGKLMIDSILQRDFNVVLAAILVTAIAIFLMNVLIDLAYALLDP
RIRH
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgctcagattcatccgtcaacgtgcgctcgcaagcctgatctcgctcatcggcctgatc
gtcatggtattcttcctgtcccggatgaccggcgacccggcggccctgtttctgcccgtc
gaagcctccgccgagatgaaggagcagttccgcgagctgcacggactgaacgatccgatc
ctcgtccagttcgcgcgctatgtgggcgatgtcgtcaccggtgacctcggcgaatccctg
cgcaaggcccgccctgcgctcgatgtcgtcctcgaagccttcacctggacactctggctt
gccgtcatcacgatgacgctcgtcacgggagcggcgatcgtcgtcggctcgctgggcgcc
ttccgctccgccggcttcttcgaccggctgtcctcgatggtctcgctcatcggtgcgtcc
gtcccggatttctggctggcgatcgtcgccatcgtcatcttctcgatcaacttcgcgatc
ctgccgacatccggcaccggatcggtcgtgcactggatcctgccgatcgcggttctcttc
gtccgccccttcggcatcatcgtccaggtggttcgcggttccatggtcagcgcgctttcc
tcagcctatgtgaagaccgcgcgggccaagggcgtgaagtccgggccgatcatcttcatc
cacgcactgcgcaatgcgatgctgcccgtcatcaccgtggtcggcgaccaggcggcgagc
ctgctgaatggtgcggtcgtggtcgagactatcttcggctttcccggcgtcggcaagctc
atgatcgattccatcctgcaacgcgatttcaacgtggtgctggcggcgatcctcgtcacg
gccattgcgatcttcctcatgaatgtgctgatcgacctcgcctatgcgctgctcgatccg
cgcatccggcactga

DBGET integrated database retrieval system