KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1458Help
Entry
C770_GR4pD1458    CDS       T02405                                 

Definition
(GenBank) UbiD family decarboxylase
Organism
smeg  Sinorhizobium meliloti GR4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:1600928..1602310
Genome map
AA seq 460 aa AA seqDB search
MEFGSQDVRYFLREYQKAYPDDVLTIEDRITDDQDASAFIWKLNQQGRAPLLHFRNVEGV
GGEVIANTFGSRERIARMFGTSQDRLHEAYQARSRQALPPRLVDGGPVTECVEEHDIDLG
TLPMLKHFATDRAKYITSGIIIAEHPETGAGNLSYHRAMIHSKNELATSLHSRGHLWRLL
NMAKDRGEKLKVAMVIGAHPLFMIAASARLAFGEDERDVAGGLIGEPLEVVRTPKYGIRV
PAYAEIVLEGVIEPEAQVAEGPFGEFTGYSSDRSTNNLFRVETFLRRKDAILVSVAGGNS
SEHLNLGRVPREAEMVEKLKQRFPSVTAVHYPASGTHFHAYVALNQTRPGEARQIMLGLL
GWDAYLKTVIAVDADVDITRDSDVLWAMSAHFQPHKDVVIIEGLPGNALDPSASGIGTTS
RMGLDATRGPDFHGVLARIDEVAFDRASTILAKLGRPWTE
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggagttcggcagccaggacgtccgctactttctccgggaataccagaaggcgtatccc
gatgacgtactcaccatcgaagaccgtatcacggacgatcaggacgcgtcggcgttcatc
tggaagctcaaccagcaaggccgggcgccgctcctgcatttccgcaacgtcgaaggcgtc
ggcggcgaagtgattgccaacaccttcggatcgcgcgagcggatcgcccggatgttcggg
acctcccaggaccggctgcacgaagcctatcaggcacgctcgcggcaagccctgccgccg
cggctggtcgacggcggaccggtcacggaatgcgtggaggagcacgacatcgacctcggc
accctgccgatgctgaagcacttcgcgaccgacagggcgaaatacatcaccagcggcata
atcatcgccgagcatcccgaaaccggcgccggcaatctcagctatcaccgcgcgatgatc
cattcgaagaacgagctggcgacgagcctgcattcgcgcggacatctgtggcggctgctc
aacatggccaaggaccgcggcgagaagctgaaggtcgccatggtcatcggcgcacatccc
ctcttcatgattgcagcctcggcgcgcctggcgttcggtgaagacgagcgcgacgtcgcc
ggcggcctcattggcgagccgctcgaggtggtacggacgccgaaatacggcatccgggtt
ccggcctatgccgaaatcgtcctggaaggggtgatcgagcccgaagcgcaggttgccgag
gggcccttcggagagttcaccggctactcgtccgaccggtcgacgaacaatctgtttcgc
gtcgagaccttcctgcgccgcaaggacgcaatcctggtcagcgttgccggcggcaactcg
tccgaacaccttaatctcggccgtgttccgcgtgaggcggagatggtggaaaagctgaag
caacgcttcccgagcgtgacggcggtgcactatccggcatccggcacgcattttcatgcc
tatgtcgccctcaaccagacgaggcccggcgaggcccgccagatcatgctcgggctgctc
ggctgggacgcctatctgaagacggtcatcgcagtcgatgccgacgtggacatcacgcgg
gactccgacgtgctttgggccatgtccgcccatttccagccgcacaaggatgtcgtcatc
atcgaaggactgcccggcaacgcgctcgatccttcggcatccggtatcggtacgacgtcc
cgcatgggcctcgacgcgacccgcgggcctgattttcacggcgtgctcgccaggatcgac
gaggtcgccttcgaccgcgcttcgacgattctcgcgaaactcggccgtccttggactgaa
tag

DBGET integrated database retrieval system