KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1464Help
Entry
C770_GR4pD1464    CDS       T02405                                 

Definition
(GenBank) Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM-like protein
  KO
K03519  
aerobic carbon-monoxide dehydrogenase medium subunit [EC:1.2.5.3]
Organism
smeg  Sinorhizobium meliloti GR4
Brite
Enzymes [BR:smeg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.5  With a quinone or similar compound as acceptor
    1.2.5.3  aerobic carbon monoxide dehydrogenase
     C770_GR4pD1464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:complement(1608481..1609344)
Genome map
AA seq 287 aa AA seqDB search
MKPFEYYEPASLAEASDLLRRLGKDASIIAGGTDLLVEMKEELRSVLHLVNIKKIPNLRD
FTYDPAAGLRFGALVTVREIETSPHVIGNYPNLAKAVSLLGSVQVRNRATIVGNICRASP
SADTIPPLIADGASLSVYNGGTERTILLEDFFTGPGRTVLSPGDIVTGISLPAPRPTSGR
AYIKHGRRKAMELATVGVAVSIEHVAGQCSDIRIALGAVAPTVIRARRTEDLIRGRRIDA
ALLAEAAESAMQEATPIGNVRASAAYRRDMVGVLTRRAIGYAMGGAQ
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgttcgaatattacgagccggcgagcctggcggaggccagcgatctgctgagg
cggctcggcaaggatgccagcatcatcgcgggcggcaccgatctgctcgtcgagatgaag
gaggagcttcgcagcgtccttcatctcgtcaacatcaagaagatcccgaacctgagggat
tttacctatgatccggccgccgggcttcgctttggcgcgctggtgacggtccgggagata
gagacctcgccgcacgtcatcggcaactatccgaacctcgccaaggcggtaagcctcctc
ggctcggtacaggtgcgcaaccgggcaaccattgtcggcaacatctgtcgcgcctccccc
tcggccgacacgatcccgcccctgatcgccgacggcgccagcctgtccgtctataatgga
ggcaccgagcggaccattctgctcgaggacttcttcaccggtcccggccggacggttctt
tcgcccggagatatcgtaaccggcatatccctgccggcgccccgcccgacgagcggccgc
gcctacatcaagcacggccgccgcaaggcgatggaactcgcgaccgtcggcgttgccgtc
agcatcgagcatgtcgccggacaatgttcggacatccgcatcgcgctcggcgccgtggcg
ccgaccgtgatccgcgcccgcaggaccgaggaccttatcaggggacgcaggatcgacgcg
gcgctgctggccgaagctgcggaaagcgcaatgcaggaagccactcccatcggcaatgtg
cgggcaagtgcggcctaccgccgcgacatggtcggcgtgctgacgcgccgggcaatcggt
tacgccatgggaggtgcccaatga

DBGET integrated database retrieval system