KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1467Help
Entry
C770_GR4pD1467    CDS       T02405                                 

Definition
(GenBank) putative ABC-type transport system, periplasmic component/surface lipoprotein
  KO
K02058  
simple sugar transport system substrate-binding protein
Organism
smeg  Sinorhizobium meliloti GR4
Module
Putative simple sugar transport system
Brite
Transporters [BR:smeg02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    C770_GR4pD1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:1611990..1612973
Genome map
AA seq 327 aa AA seqDB search
MMITRRGCLGSAVAMAALIAAGPAFAEGSPFKMGLLVPGSVSEEGWNRIGFNALKGVEAE
LGAEVSYVELQQNPASFEKAFRDFASQGYNVILGHGFEFQDAALEVAPEYPDTVFLISSS
YIFEGNVIGLNTDTSQPFYLMGVIAAKTGKKAGLVGGMEIPPIKEAFEGFTNGVRSVAPD
FPVSEVYIGNFTDATATKEASLSLISQGADFVLPNASGATVGGFQAAAESGADVKTFSIF
SDYTSVAPKNILGLYVADYARGVIRIVGDIRNGKKPTTNVEFGLKDADVMKFTYNDQAAN
PVTEDVRKYVDEVKGKIAAGEIKTRQK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgatgattaccagaagaggctgtttggggtcggcggttgcaatggccgcgctcattgcc
gcggggccggctttcgccgagggctcaccgttcaagatgggactgctggttcccggcagt
gtttcggaagaaggatggaacaggataggcttcaacgcactcaagggcgtggaggcggaa
cttggtgccgaggtcagctatgtcgagctgcagcagaacccggcatccttcgagaaagcc
ttccgtgacttcgccagccagggctacaacgtcattctcgggcacggcttcgagtttcag
gatgccgctctcgaggtcgcgccggaatatcccgatacggtctttctcatttcctcgagc
tatatattcgagggaaatgtcatcggcctcaacacggatacgagccagcccttctacctg
atgggcgtgatcgcggccaagacgggcaagaaggcgggtctcgtcggagggatggagatc
ccgccgatcaaggaggccttcgagggcttcaccaacggtgtgcgaagcgtcgcgccggac
ttccccgtcagcgaggtctatatcggcaacttcaccgatgcgaccgcgaccaaggaggcg
agcctcagcctgatctcgcaaggggccgacttcgtgctgccgaatgcttcaggggcgacg
gtgggcggtttccaggccgccgcggaatccggtgccgacgtcaagaccttcagcatcttc
agcgattacacctcggtcgctcccaagaacatcctcgggctttacgtcgccgactatgcc
cggggcgtcatccgcatcgtcggagacatcaggaacggcaaaaagccgacgaccaatgtc
gagttcggcctgaaagatgccgacgtcatgaagttcacctacaatgatcaggctgcaaat
cccgtgacggaggacgtgcgcaaatacgtcgatgaggtgaagggcaagatcgccgccgga
gaaatcaagacccggcagaaataa

DBGET integrated database retrieval system