KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1470Help
Entry
C770_GR4pD1470    CDS       T02405                                 

Definition
(GenBank) ABC-type uncharacterized transport systems, ATPase component
  KO
K02056  
simple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
smeg  Sinorhizobium meliloti GR4
Module
Putative simple sugar transport system
Brite
Enzymes [BR:smeg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     C770_GR4pD1470
Transporters [BR:smeg02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    C770_GR4pD1470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:1615174..1616700
Genome map
AA seq 508 aa AA seqDB search
MAGKQLLLMDGIHKRFGPLIVSAGVTLDVEENEIHALLGENGAGKTVLMSILCGVLSPNE
GQIVFKGRPLKLGSPREAIKHRIGMVHQHFMLVPNLTVAENYVLGQGSPFSMIRDMRAVH
ARILELSDRYGLDVAPDALVSSLSVGERQRVEILKVLYHGIELLILDEPTAVLTPQETDR
LLHLLRQLVADGKTVIFISHKLDEVMRVSDRVSVMRDAKVVRTVKTSETTARELARMMVG
RDVLMDLPRAPLEPGRVVLSVEHLSCDGEAGLPALRDVSFEVRANEIVGIAGVSGNGQSE
LALALTGLLPVASGSVTLDGTQLAGLSSYEINQLPMAHIPEDRHRMGIVLPLPLTENVIL
QRFDKPPFSSRGLLDLNEITRQTRDLMRRFKVKASGPGDRIRNLSGGNQQKLVVGRELDR
RFDFLLINQLTRGIDIGATELVMHKILEQRSAGKAILLISTELEELFTLSDRILVMYEGR
LVGEIPPDRSRLEEIGLLMAGKSPLSAA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaaacaactgcttttgatggatggaatccataaacgattcggaccgctcatc
gtcagcgcaggcgtgaccctcgacgtcgaggagaacgagattcacgcgctgcttggcgaa
aacggcgccggcaagaccgttctgatgagcattctttgcggtgttctctcgcccaatgaa
gggcagatcgtcttcaagggacggccactcaagctaggctccccccgcgaagccatcaaa
catcgcatcggcatggtccaccagcacttcatgctggtccccaacctcacggtcgcggaa
aactacgtgctaggacagggctcgcccttcagcatgatccgcgacatgagggcggtacat
gcgcgcattctggagctcagcgaccgctacggtctcgacgtcgcgcccgacgcgctcgtc
tccagcctgtcggttggcgaacggcagcgggtcgagatcttgaaggtgctctaccacggc
atcgaactgctgatcctggacgagccgaccgcggtcctgacgcctcaggaaaccgaccgt
ctcctgcatctgcttcgccaactcgtcgcagacggaaagacggtcatcttcatttcgcac
aaactggacgaggtgatgcgcgtcagtgatcgcgtcagcgtcatgcgcgatgccaaggtc
gtccgtacggtgaaaacgtccgagacgaccgcgcgcgagctggcgcgcatgatggtcggc
agagacgttctgatggatttgccgcgggcacctctcgagcccggccgtgtcgtgctgtcg
gtcgagcatctcagctgcgacggcgaagccgggcttccggcgctgcgagacgtatctttc
gaggtcagggccaatgaaatagtcgggatcgcaggcgtctccggcaatggccagagcgag
ctggcgctggccctgacggggcttcttccggttgcctccggcagcgtcacgctcgacggg
acccagctggcgggcctgtcgtcctacgagatcaatcaattgcctatggcgcatatcccc
gaggaccgccacaggatgggcatcgtgctgccgctgccactgacggagaatgtgatcctt
cagcggttcgacaagcctcccttctcgtctcgtggattgctcgacctgaacgagatcacg
aggcagacccgtgatctcatgcgccgcttcaaggtcaaggcgtcgggaccgggcgaccgc
atccggaatttgtcgggcggcaatcagcagaagctcgtcgtcgggcgcgagttggaccgc
cggttcgatttcctgctgatcaatcagcttacgcgcggtatcgacatcggagcgaccgag
ctggtgatgcacaagattctcgagcagcgcagcgccggcaaggccattctgctgatatcc
acggagctcgaggaattgttcacgctctccgaccgcatcctcgtcatgtatgaaggccgc
ctcgtcggcgagattccgcccgaccgcagccgtctcgaagagatcgggctgctgatggcc
ggcaaatctccgctatcggcagcttga

DBGET integrated database retrieval system