KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1485Help
Entry
C770_GR4pD1485    CDS       T02405                                 

Definition
(GenBank) ABC-type dipeptide transport system, periplasmic component
  KO
K02035  
peptide/nickel transport system substrate-binding protein
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Quorum sensing
Module
Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    C770_GR4pD1485
Transporters [BR:smeg02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    C770_GR4pD1485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:complement(1631963..1633471)
Genome map
AA seq 502 aa AA seqDB search
MTIRYCTRAVALLTATLFSGVAMAAEGEVKIVLPEQPANLDPCRSIRSDIGRIINSNITE
TLTVIDTEKGTVGPWLAEKWEQVDDLTWRVHLKSGVKFQDGAAFDAEAVVKSINRLMNPG
LTCDSRSKFGDVKLTPKAVDAQTVEISSDSPVPIMPTLLGTVQIVSPNMPFDKESNDPVG
TGPYVVESKSNEQIVLKRHDAYWGAKPDVTRATYVWRSESAIRAAMVESGEADMTPSIAV
QDATNAESDFAYLNSETTRMRIDAQIPPLDDVRVRKALNMAIDWDGMGEALFGKDVLRAS
QMVVPGVRGHNPDIKPWTYNPEEAMKLVEEAKAAGAPVDKEIVLIGRNGFFPNSAESLEA
MRSMWQEIGLNVSIRQLEAADWVRYLDKPFPEGRGPTLFQQQHDNNTGDAGFTAPVMYLS
EGQYSTIADPDLDVVLKKAMAATGDEREKLFQEVFAKVHDEIVADVPMYHMIGYVRVGSR
LDWKPDLKTNSEIALSEIHFKD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccgctattgtacccgcgccgtggcgctcttgaccgcgacgctcttttccggc
gtcgcgatggccgccgaaggcgaggtgaagatcgtattgccggagcagccggccaacctc
gatccctgtcgctccatcaggtcggatatcggccgcatcatcaattccaacattaccgag
accctgaccgtcatcgacacggagaagggcaccgtcggcccctggcttgctgaaaaatgg
gagcaggtggacgatctgacctggcgtgtgcatctcaagagcggcgtcaagtttcaggac
ggcgcggcgttcgatgccgaagcggtggtcaagtccatcaatcgccttatgaaccccggc
ctcacctgcgacagccgctcgaaattcggcgacgtcaagctgacgccgaaggcggtcgat
gcgcagacggtggagatctcctccgacagcccggtgccgatcatgccgacgctgctcggc
accgtgcagatcgtctcccccaacatgccgttcgacaaggaaagcaacgatcccgtgggc
acgggaccctatgtggtcgaaagcaagtccaacgagcagatcgtcctgaagcgtcacgat
gcttactggggcgccaagccggacgtcacgcgcgcaacctatgtctggcgcagcgagtcg
gccatccgggcggccatggtcgaatccggcgaagcggacatgaccccatccatcgccgtg
caggacgccaccaatgccgagtctgactttgcctatctgaactccgagacgacgcgcatg
cggatcgatgcgcagatcccgccgctcgacgacgtccgcgtccgcaaggcgctcaacatg
gctatcgactgggacggcatgggcgaagcgctgttcggcaaggacgtcctgcgggcctcg
caaatggtcgttccgggcgtgcgcggccacaatcccgatatcaagccatggacctacaat
cccgaagaggcgatgaagctggtcgaggaagccaaggccgcaggcgctccggtcgacaag
gagatcgtgctgatcgggcgcaacggcttcttcccgaactcggccgaaagcctcgaagcg
atgcggtccatgtggcaggagatcgggctcaacgtctcgatacgccagctcgaagcggcc
gactgggtgcgctatctcgacaagcccttcccggagggacgcgggccgacgcttttccag
cagcagcacgacaacaatacgggcgacgccgggtttaccgctccggtcatgtatctgagc
gagggacaatattcgacgatcgccgatcccgacctcgacgtcgtgttgaagaaggcgatg
gccgcgaccggcgacgagcgtgaaaagctgtttcaggaggtcttcgcgaaggtgcacgac
gaaatcgtcgcagacgtgccgatgtaccacatgatcggctatgtccgcgtcggctcgcgc
ctcgactggaagccggatctcaagacgaacagcgagatcgcgctctccgagatccatttc
aaggactga

DBGET integrated database retrieval system