KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1487Help
Entry
C770_GR4pD1487    CDS       T02405                                 

Definition
(GenBank) Transcriptional regulator
Organism
smeg  Sinorhizobium meliloti GR4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:complement(1634619..1635350)
Genome map
AA seq 243 aa AA seqDB search
MPEKSPILESLAEARPSSYADQVYGRILHDILNGIFQPGARLPTENELAERFGVSRPVVR
EALARLRVDGLVEARRGSGTYVLSRPSQDLPNLADLEDISRFLRYQELRFYVEGQAAALA
AERRTEKQLAAIIEAHEAFAHEVGRGAFLPESDRRFHLAICEGTGNEFFAKALEGPEVSL
TSFMNVSLALTRSGSQARARRVIAEHAEIVEAIRTKDAVWARVAMETHIINARRRMTDGT
IDS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagaagtcgcccatcctcgaaagcctagccgaagcccgcccgtcgagctatgcc
gatcaggtctacgggcgcatcctgcacgacatattgaacggcatctttcaaccgggcgca
cgtctgccgacggaaaacgaactcgccgaacgcttcggcgtctcgcggccggtcgtccgc
gaggcgcttgcgcgcctgcgggtcgacggcctcgtggaagcgcggcgcggcagcggcacc
tatgtcttgagcaggccctcgcaagatctgccgaacctggccgacctggaggatatttcg
cgcttcctgcgctatcaggagcttcgtttctacgtggaaggccaggcggcagcactggca
gcggagcggcgcacggaaaagcagcttgccgccattatcgaggcccatgaggccttcgcc
catgaggtcggccgcggggccttcctgccggaaagcgacaggcgtttccatcttgcgatc
tgcgaggggacgggaaacgagtttttcgccaaggcgctggagggcccggaggtttcgctg
accagcttcatgaacgtttcgcttgccctcacccggtccggatcgcaggcacgtgcccgc
cgggtcattgccgaacatgccgagatcgtcgaagcgatccgcacgaaagatgccgtatgg
gcgcgggtggcgatggaaacgcacatcatcaacgcgcgccgaaggatgacggacggtaca
atcgactcctga

DBGET integrated database retrieval system