KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1494Help
Entry
C770_GR4pD1494    CDS       T02405                                 

Definition
(GenBank) Glycosidase
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C770_GR4pD1494
Enzymes [BR:smeg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     C770_GR4pD1494
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     C770_GR4pD1494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:complement(1643416..1645050)
Genome map
AA seq 544 aa AA seqDB search
MKEAPWFSSSVIYGIDVRRFSDGNGDGIGDFIGLKERVSYLHYLGIDCVWLSPFFRSPFA
DNGYDVSDYYSIDPVLGTLDDFLDFLHAAGEQGIRVVVDLVANHTSSEHPWFQAARRDAR
CRFRDYYVWSESPPPVAPDNKTAFPGEESSVWTYDDLAQAYYFHKFRHFQPDLNIANPAV
RDELLRVVDYWLTLGVDGFRVDAAPFLIGETGIEHADPRDPQGFLREMRKLVDGRRQDGL
LLGEADLAPEKLRSYFGDGKLDLLFNFVLCAAFAASLAGQKADPIGQALSIMPEPPPHRG
WANFLRNLDELNLDRLPEDIREETFAAFAPDEEMRIYGRGIRRRLAPMLDGNRARIELAF
SLLLSSPGVPLILYGDEIGLGEDLSRPGREPVRVPMQWNAGSNAGFSTAQRAKLVQPPVT
DGPFSFKRVNVEAQREDPGSLLNRVRAMILARRRHELFNRGRPVMLHTGDPALFALAYSD
GTELFVVLHNLSDGKRRAELELPGAIDARLNDILGEGEVELSGQRLAIGLGPFGYVWLHS
GKKD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggcgccgtggttctcgagctcggtcatctatggaatcgacgtgcgcagattt
tcggacggaaatggcgacgggatcggcgacttcataggtctcaaggagcgcgtgtcttat
ctgcactatctgggcatcgactgtgtctggctctcgcccttcttcaggtccccctttgcc
gataacggctacgacgtcagcgactattattccatcgatccggttctcggaacgctggac
gacttcctggatttcctgcacgccgccggcgaacagggcattcgcgtcgtcgtcgatctc
gtcgccaaccacacatccagcgagcatccgtggttccaggcggcgcggcgcgacgcgagg
tgccgcttccgcgactattacgtctggtcggaaagcccgccgccggtcgctccggacaac
aagacggcgtttcccggcgaggaaagcagtgtctggacctatgacgatctcgcccaggcc
tattacttccacaagttccgccatttccagccggacctgaacatcgccaacccggcggtg
cgagacgaattgcttcgtgtagtcgactattggctgacattgggcgtcgacggattccgg
gtggatgccgcgccattcttaatcggcgaaaccggcatagagcacgcggaccccagggac
ccccagggctttctcagggaaatgcgcaagctggtcgacgggaggcgccaggacggcctt
ctgctcggcgaagcggacctggcgccggaaaagctgcggtcctatttcggcgacggaaag
ctcgaccttctgttcaacttcgtgttgtgtgcggctttcgccgcgagcctcgcggggcag
aaggccgaccccatcggccaggcgctttcgatcatgccggagccgcctccccatcgcggc
tgggcgaacttccttcgcaatctcgacgaactgaacctcgatcgcctgccggaagacatt
cgagaggaaacctttgcagccttcgccccggatgaggagatgcggatctacggacgcggc
atcaggcgccgcctcgcgccgatgctggacggaaaccgggcgagaatagaactcgccttc
agtctgcttctgtcttccccgggcgtgccgctcattctctacggcgacgagatcggcctt
ggcgaggacctttcccgaccgggccgggagccggtccgcgtgcccatgcagtggaatgcg
ggttccaatgccggcttctccaccgcccagcgcgccaaactcgtccagccgccggtgaca
gacggcccattctccttcaagcgggtcaatgtcgaagctcagcgtgaggacccggggtcg
cttctgaaccgcgtgcgggcgatgatcctggcgcggcgccggcacgagctcttcaacagg
ggacgcccggtcatgctgcacaccggagacccggcgctgttcgcgctggcctattccgac
ggcaccgaactattcgtggtgctgcacaatctttcggacggcaagcggcgggcggagctc
gaactgcccggcgcaatcgacgccaggctcaatgacattctcggcgagggtgaggtcgag
ctttccgggcagcgtctggcgatagggctcggtccgttcggctacgtctggcttcattcg
ggaaagaaggattga

DBGET integrated database retrieval system