KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1500Help
Entry
C770_GR4pD1500    CDS       T02405                                 

Definition
(GenBank) putative integral membrane protein
  KO
K07027  
glycosyltransferase 2 family protein
Organism
smeg  Sinorhizobium meliloti GR4
Brite
Transporters [BR:smeg02000]
 Other Transporters
  Others
   C770_GR4pD1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:complement(1650773..1651714)
Genome map
AA seq 313 aa AA seqDB search
MSRKILARLFIAAGICVAGWLIYRTLSQHSFHEIAGSIMRIPARNLFVGIGFVFLSYFCL
TLFDTLAIRYVGRKLAYPQIAIASFTSLSIGHNVGGAALSSGAVRYRFYSRWGLSAEEVA
KVILFCGVTVGLGLVALAGLCFLIVPSDAARLTGFSTTGAFLLGTACIGAAAGYVLLAYF
LRGSVRIFRWTFEMPSVGIAALQVVVGVANFLCVSAALHQLLSAFEEVSFIDTAMAYVGA
GVTAIVSHVPGGIGVLEATIAFLLGSSASLGALIAFRAIYFFLPLPLGLISLSVAEFVAR
RDEEKSLVSKAKS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaaaattctagcgagactgttcatcgctgccggtatctgcgtggcgggctgg
ttgatctatcgcaccctcagccaacatagctttcatgaaatcgctggttcgatcatgcgg
attccggcccggaatctctttgtgggcatcggtttcgtcttcctttcctatttctgcctg
accctcttcgacaccctcgctatccgctatgtcgggcggaagctcgcctatccgcaaatc
gccatcgcctccttcaccagcctttcgatcggccacaatgtcggcggcgcggccttgagc
agcggtgccgtccgctaccggttctactcgcgctgggggttgagcgccgaagaggtggcg
aaggtcattctgttctgcggcgtcaccgtcggcctcggccttgtcgcattggccgggctt
tgttttctgatcgtgccttcggatgccgcgcggcttaccggattttccacgaccggcgct
ttcctgctcggcactgcctgcataggggccgcggccggttacgtcctgctcgcttatttt
ctgcggggttcggttcgcatctttcgctggactttcgaaatgccctcggtggggattgct
gccttgcaggtcgtcgtcggagtcgccaacttcctctgcgtcagcgcagcgttgcatcag
ctgctcagcgccttcgaggaggtgagtttcatcgacacggccatggcctatgtcggggcc
ggcgtgaccgcgatcgtcagccatgtccccggcggaatcggcgtactcgaggcgacaatc
gcatttctgcttggcagttcggcgagcctgggcgctctgatcgcctttcgggcgatctat
ttcttcctgccgctgccgctcggcttgatctcgctttcggtcgctgagttcgtcgcccgt
cgggatgaggaaaaaagcctggtgagcaaggcgaaaagctga

DBGET integrated database retrieval system