KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1501Help
Entry
C770_GR4pD1501    CDS       T02405                                 

Definition
(GenBank) Metal-dependent hydrolase
Organism
smeg  Sinorhizobium meliloti GR4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:1651725..1652522
Genome map
AA seq 265 aa AA seqDB search
MRTHRNEKQVLRVPKAMRQRIRFLTYNVHSCFGTDRRLDPARIAAVIAECQPDVIAMQEV
DVGRARTGGIDQAHMIATHLNMEAEFHPALHLEDEKYGDAVLTALPMRLIKAAPLPSSGE
PRGALWVEIDVAAVKLQVIVTHLGLRGTERLRQATALLGPGWLGGMAQGDAHVVLAGDLN
ATGRSTAYRLLARQLSDAQLLTGAKPRPTFPSRLPLLRIDHVLIGKGIEVASCRVHGSTL
ARSASDHLPLLAELDVVMRDKQEPS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcacccaccggaacgaaaagcaggtgctgcgtgttccgaaggcgatgcgacagcgg
atacgtttcctcacctacaacgttcacagctgcttcggcaccgaccgcaggctcgatccc
gcgcgcatcgccgccgtcatcgccgagtgccagcccgacgtcatcgcaatgcaggaagtc
gacgtcggccgcgcccgcaccggcggaatagaccaggcccatatgatcgccacgcatctc
aacatggaagccgagttccatccggctctccacctggaggacgagaaatacggagacgcc
gttctgacggccttgcctatgcggttgatcaaggcagcacccctcccctcgtccggcgag
ccgcggggcgcgctctgggtggagatcgacgtcgccgcagtcaagcttcaggtgatcgtg
acgcatctcggattgcgcggcaccgagcgcctgcgccaggcgaccgcccttctaggcccc
ggctggctcgggggaatggcccagggagacgctcacgtggtcctggcaggtgatctcaac
gccacggggcgttcgaccgcctacaggctcctggcccgacagctcagcgacgcgcaactg
ctgaccggcgccaagcctcggccgacctttccatcgcgattgccgctgctgcgcatcgat
cacgtgctgatcgggaaaggcatagaagtggcttcctgcagggtgcacggcagcaccctg
gcgcgaagcgcttcggatcatcttccgctgcttgccgaactggacgtcgtgatgcgggac
aagcaggaaccgtcctga

DBGET integrated database retrieval system