KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1509Help
Entry
C770_GR4pD1509    CDS       T02405                                 

Definition
(GenBank) Protein of unknown function (DUF1328)
Organism
smeg  Sinorhizobium meliloti GR4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:1657210..1657383
Genome map
AA seq 57 aa AA seqDB search
MLKWALIFFVISLIAGFLGFSGVSAATAGIAKILFYIAVIIFLVFLVLALAVGGAVT
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagtgggcactgattttcttcgttatttcactgatagccgggttcctcgggttc
tccggcgtctcggccgcgacggcggggatcgcgaaaatactcttttacattgcggttatt
atcttcctcgttttcctcgtattggcactggccgtcggaggtgccgtgacctaa

DBGET integrated database retrieval system