KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1510Help
Entry
C770_GR4pD1510    CDS       T02405                                 

Definition
(GenBank) hypothetical protein
Organism
smeg  Sinorhizobium meliloti GR4
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:complement(1657507..1657746)
Genome map
AA seq 79 aa AA seqDB search
MPVISPTIHTQQNSRELECQRAMEDEFLVLTALAEEAGWSWQEIALAMLELTEQYVAAMR
PSSAMEARSLLRSHSKSLH
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcatcagccccacgatccacacccagcaaaacagccgggagcttgaatgtcag
cgcgcaatggaggacgagttcctggtccttacggccctggccgaggaagcgggctggtca
tggcaggaaatcgcgctcgccatgttggagttgaccgagcaatatgttgcagccatgcgg
ccgagttcggcgatggaggcgagatcactcctgcgcagtcactccaagagcttgcactga

DBGET integrated database retrieval system