KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1527Help
Entry
C770_GR4pD1527    CDS       T02405                                 

Definition
(GenBank) hypothetical protein
  KO
K09165  
uncharacterized protein
Organism
smeg  Sinorhizobium meliloti GR4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
pRmeGR4d:complement(1676692..1676901)
Genome map
AA seq 69 aa AA seqDB search
MSEHVYKKIELIGSSPNSIDEAIEGAISRASKTTRNLDWFEVDQIRGQIVNGKVAHYQVV
MKVGFRIDD
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcacgtctacaagaagatcgagttgatcggcagttcgccgaactcgatagac
gaggccatcgaaggggcgatttcgcgtgcttcgaaaaccacccgcaatctcgactggttc
gaagtggaccagattcgcggccagatcgtgaatggcaaggtcgcgcattaccaggtggtg
atgaaggtgggcttccgcatcgacgattga

DBGET integrated database retrieval system