KEGG   Sinorhizobium meliloti 2011: SM2011_a0414Help
Entry
SM2011_a0414      CDS       T02497                                 

Definition
(RefSeq) hypothetical protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:smel00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SM2011_a0414
Enzymes [BR:smel01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SM2011_a0414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSymA:224470..226140
Genome map
AA seq 556 aa AA seqDB search
MADNLSKDRAKRDFKKTREPSGEAQVKPSNRRRFVIQKHDATRLHYDLRLELDGVFKSWA
VTKGPSLDPSDKRLAVEVEDHPLDYGDFEGTVPKGQYGGGTVMLWDRGYWEPEGRKSPEE
ALKKGDFKFTLHGKRLHGSFVLVRMRNDRDGGKRTNWLLIKHRDDYSVDENGAAILEENA
TSVASGRSMEQIAEGTGRKPRPFMMANADVEADAVWDSKHGLAAEERKKGSRRDVATSTA
ADLPDFIEPQLCETLARPPASDDWLHEIKFDGYRIQMRIADGKVTLKTRKGLDWTAKYPE
IADAASELPDCIIDGEICALDDNGAPDFAALQAALSEGKTGNLVYFAFDLLFDGGEDLRS
MRLVERKKRLEDFLAAGSDDPRIRYVDHFESGGDAVLRSACKLSLEGIVSKQMDAPYQSG
RTDTWAKSKCRAGHEVVIGGYATTNGKFRSLLVGVHRGDHFVYVGRVGTGFGAAKVERFF
PKLKALEASKSPFTGIGAPKKEKEVTWLPDGRALPACRVRSSTDVVRFRRSGRSPRALRS
DRSEGRASCPRRLSPV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaatctttcgaaagaccgtgccaagcgcgatttcaagaaaaccagagaacca
agcggcgaggctcaggtcaagccgtcgaaccgccggcggttcgtgatccagaagcacgac
gccacccggcttcactatgatctgcggcttgaactggacggggtgttcaagagctgggcg
gtgaccaagggcccatcgctcgatcctagtgacaagcgactggccgtcgaagtcgaagat
cacccgctcgactatggcgacttcgaaggcacggttccaaagggccagtatggcggcggc
acggtcatgctatgggaccgcggctattgggagccagaaggtaggaagtcacctgaagag
gccctgaagaagggcgacttcaagttcacgcttcatggcaagcggctgcatggcagcttc
gtcctggtgcggatgcgcaacgatcgcgatggcggcaagcggaccaactggctgctcatc
aaacatcgtgacgattactccgttgacgagaacggcgcggcaatcctggaggagaacgcg
acttccgtcgcctccggccgcagcatggagcagatcgccgagggcacgggccgcaagcca
cgaccgttcatgatggcgaacgcggatgtcgaggcagatgccgtctgggacagcaagcat
ggcttggcagcggaagagcgcaagaaggggtctcgcagggatgtcgcgacctccacggca
gccgacctgccggattttatcgagccgcagctctgcgagacgcttgcgcggccgccggcc
agcgacgactggctgcatgagatcaagttcgacggttatcggatccagatgcggattgcc
gacggtaaggtgacgctgaagacgcgcaagggtctcgactggaccgcgaaatatccagag
atcgccgatgctgcgtccgaattgcccgattgcatcattgatggcgaaatctgcgccctc
gacgacaatggcgcgcccgatttcgcagcactccaagccgcgctctcggaaggcaagacc
ggcaaccttgtctacttcgccttcgacctgctgtttgatggcggcgaggacttgcggtcg
atgcgattggtcgagcggaagaagcggctcgaagacttcctcgcggccgggagcgacgat
ccgcgtatccgctacgtcgatcacttcgaatccggcggtgacgcggtgctccgctccgcc
tgcaagctgtcgctcgaaggtatcgtctccaagcagatggatgcgccctaccaatcgggc
cgcaccgacacctgggcgaagtcgaaatgccgggctggtcatgaggtggtgatcggtggc
tatgctacgaccaacggcaagtttcgatctctcctggtcggcgttcaccgcggcgatcac
ttcgtctatgtcggccgggtcggcacgggcttcggcgccgcgaaggtcgagcggttcttt
cccaagctgaaggcgttggaagcatcgaagtcacccttcaccggcatcggtgcgccgaaa
aaggagaaggaagtcacctggctgccagacggccgggcacttccggcttgccgggttcgc
agttccacggatgtagttcgattccgccgatctgggcgatcgccgcgagcccttcgatcc
gatcgatctgaaggtagggcttcctgtccccgaagactttcaccagtttga

DBGET integrated database retrieval system