KEGG   Sinorhizobium meliloti 2011: SM2011_a1711Help
Entry
SM2011_a1711      CDS       T02497                                 

Definition
Arginase/agmatinase/formimionoglutamate hydrolase family protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smel01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:smel00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSymA:961986..962879
Genome map
AA seq 297 aa AA seqDB search
MPTLPYAILEAPSTLGLATHGVERLPDQLLHLGLAERIHARHAERLAVPPKEPTPDPETG
ILNARAIAAWSPKLADAVEAVLTAGEFPVVLGGDCTIVLGSMLAFRRRGRYGLLFIDGNA
DFFQPEAEPNGEGASMDLALVTGYGPSHLTDIEGRGPLVRPEDAVAFAYRDHKDQEEYGS
QALPNELKAIDLPAVRAVGIEAAAREAVDHLTREELDGFFIHLDADCLDDAIMPAVDFRM
PGGLSWDELGTALRVALASGKAVGIEITIYNPRLDESGSAGRDLADVLATALGTAAS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccttccttatgcaattctcgaagccccttccacgttgggactggcgacccac
ggagtggagcgcctgcccgaccaactcctgcatctcggtcttgcggagcgcatccatgcg
cgccacgccgagcggctggcggtgcctccgaaggagcctacgccagatcccgagaccggc
atcctgaatgcgagggcaattgcggcttggtcgcccaagctcgccgacgcggtggaagcg
gtgcttaccgcgggcgaatttccggtggtactgggcggcgattgcacgatcgtgctgggc
tcgatgctcgcgtttcgccgacgcggccgctacggcctgctcttcatcgacggcaacgcc
gatttcttccagcccgaggcggagcctaatggtgagggcgcctccatggaccttgccctc
gttaccggctacggcccgtcacatctgaccgacattgaaggtcgcggtcctctggtccgt
cccgaagacgctgtcgcgttcgcatatcgcgatcataaggatcaggaggagtacggaagc
caggcgctccctaacgagctcaaggcgattgatcttcccgccgtgcgcgcagtgggcatt
gaggccgccgcgcgcgaagcggttgaccacctgacgcgagaggaactggacggcttcttc
atccatctcgacgccgattgcctcgacgacgccatcatgccggctgtcgatttccgcatg
ccgggcgggttgtcgtgggacgagctagggaccgcgcttcgggttgccttggcgagtggc
aaggcagtcggcatcgagatcaccatctacaatccgcgccttgatgagtccggcagcgcc
gggcgcgacctggccgacgtactggccacagccctcggaacagcagcgtcctga

DBGET integrated database retrieval system