KEGG   Sinorhizobium meliloti 2011: SM2011_a1711Help
Entry
SM2011_a1711      CDS       T02497                                 

Definition
(GenBank) Arginase/agmatinase/formimionoglutamate hydrolase family protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00220  Arginine biosynthesis
smel00330  Arginine and proline metabolism
smel01100  Metabolic pathways
smel01110  Biosynthesis of secondary metabolites
smel01130  Biosynthesis of antibiotics
smel01230  Biosynthesis of amino acids
Module
smel_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:smel00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SM2011_a1711
   00330 Arginine and proline metabolism
    SM2011_a1711
Enzymes [BR:smel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SM2011_a1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGG70633
Position
pSymA:961986..962879
Genome map
AA seq 297 aa AA seqDB search
MPTLPYAILEAPSTLGLATHGVERLPDQLLHLGLAERIHARHAERLAVPPKEPTPDPETG
ILNARAIAAWSPKLADAVEAVLTAGEFPVVLGGDCTIVLGSMLAFRRRGRYGLLFIDGNA
DFFQPEAEPNGEGASMDLALVTGYGPSHLTDIEGRGPLVRPEDAVAFAYRDHKDQEEYGS
QALPNELKAIDLPAVRAVGIEAAAREAVDHLTREELDGFFIHLDADCLDDAIMPAVDFRM
PGGLSWDELGTALRVALASGKAVGIEITIYNPRLDESGSAGRDLADVLATALGTAAS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccttccttatgcaattctcgaagccccttccacgttgggactggcgacccac
ggagtggagcgcctgcccgaccaactcctgcatctcggtcttgcggagcgcatccatgcg
cgccacgccgagcggctggcggtgcctccgaaggagcctacgccagatcccgagaccggc
atcctgaatgcgagggcaattgcggcttggtcgcccaagctcgccgacgcggtggaagcg
gtgcttaccgcgggcgaatttccggtggtactgggcggcgattgcacgatcgtgctgggc
tcgatgctcgcgtttcgccgacgcggccgctacggcctgctcttcatcgacggcaacgcc
gatttcttccagcccgaggcggagcctaatggtgagggcgcctccatggaccttgccctc
gttaccggctacggcccgtcacatctgaccgacattgaaggtcgcggtcctctggtccgt
cccgaagacgctgtcgcgttcgcatatcgcgatcataaggatcaggaggagtacggaagc
caggcgctccctaacgagctcaaggcgattgatcttcccgccgtgcgcgcagtgggcatt
gaggccgccgcgcgcgaagcggttgaccacctgacgcgagaggaactggacggcttcttc
atccatctcgacgccgattgcctcgacgacgccatcatgccggctgtcgatttccgcatg
ccgggcgggttgtcgtgggacgagctagggaccgcgcttcgggttgccttggcgagtggc
aaggcagtcggcatcgagatcaccatctacaatccgcgccttgatgagtccggcagcgcc
gggcgcgacctggccgacgtactggccacagccctcggaacagcagcgtcctga

DBGET integrated database retrieval system