KEGG   Sinorhizobium meliloti 2011: SM2011_b20008Help
Entry
SM2011_b20008     CDS       T02497                                 

Definition
(RefSeq) DNA ligase (ATP) (EC:6.5.1.1)
Organism
smel  Sinorhizobium meliloti 2011
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSymB:12297..13364
Genome map
AA seq 355 aa AA seqDB search
MASSAHGKPTKKAAPSSAAKKAGGFPLPVSTAPMEARSATELPGGDAWQYEPKWDGFRCL
AFKSGDEVDIRAKSGKPLGRFFPEIVALLRRLEPDMFVLDGELVIEVDGRLSFDALQMRL
HPAASRVQKLSQETPAKLILFDMLAGTDGTILTGEPLQTRRACLEAFAKKNAVAEMLESS
PFTLDIKEAERWLTSWEAGATDGVVAKRRDGVYECGERAMVKVKRLKTADCVVGGFRYES
DSSLVGSLLLGLYDTEGLLNHVGFTATISDKERPALTNQLEALREPPGFTGKAPGGPSRW
SSERSGEWEPVRPELVVEVRFDHVSNRRFRHGTKLMRWRPDKDPRQCTYQQIMPS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtccgcacatggaaagccgacgaagaaggccgctccgtcaagcgcggcgaag
aaggcgggcggctttcccctgcccgtcagcacggcgccgatggaggcgcgatccgcgacc
gagcttccgggcggcgacgcatggcagtatgagccgaagtgggacggctttcgctgcctt
gcgttcaagtccggcgacgaagtcgatataagggcgaaatccggcaagccgctcgggcgc
ttcttcccggagatcgtcgccctcttgcgccggctggagccggacatgttcgtcctcgac
ggcgaactggtgatcgaggtcgacgggcgcctctccttcgacgccctgcagatgcgcctg
catccggcggcaagtcgcgtgcagaagctctcgcaggagacgccggccaagctcatcctg
ttcgacatgctggccggcacggacggaacgatcctgaccggtgaacccctccaaacccgc
cgcgcctgcctcgaagcgttcgccaagaagaacgccgttgctgagatgctggagtcttcg
cccttcacgctcgacatcaaggaggccgagcggtggctcacctcatgggaggcgggtgca
accgacggggtggtcgcaaagcggcgcgacggcgtatacgaatgcggcgaaagggcaatg
gtgaaggtcaaacggctgaagacggccgattgcgtcgtcggcggcttccgttacgagagc
gacagctctttggtgggctcgcttctgctcggcctttacgacaccgagggactgctgaac
catgtgggctttaccgcgacgatctcggacaaggagcggcccgccttgaccaaccagctc
gaagcattgcgggagccgccgggcttcaccggcaaagcgccgggcgggcccagccgctgg
agcagcgagcgcagcggcgaatgggagccggttcgcccggaactggtcgtcgaagtccgg
ttcgaccatgttagcaaccggcgcttccgtcacggtacgaaactcatgcgctggcggccg
gacaaggacccgcgccaatgtacctatcagcagatcatgccgtcgtga

DBGET integrated database retrieval system