KEGG   Sinorhizobium meliloti 2011: SM2011_b20008Help
Entry
SM2011_b20008     CDS       T02497                                 

Definition
DNA ligase (ATP) (EC:6.5.1.1)
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:smel00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SM2011_b20008
   03420 Nucleotide excision repair
    SM2011_b20008
   03430 Mismatch repair
    SM2011_b20008
   03450 Non-homologous end-joining
    SM2011_b20008
Enzymes [BR:smel01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SM2011_b20008
DNA repair and recombination proteins [BR:smel03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SM2011_b20008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSymB:12297..13364
Genome map
AA seq 355 aa AA seqDB search
MASSAHGKPTKKAAPSSAAKKAGGFPLPVSTAPMEARSATELPGGDAWQYEPKWDGFRCL
AFKSGDEVDIRAKSGKPLGRFFPEIVALLRRLEPDMFVLDGELVIEVDGRLSFDALQMRL
HPAASRVQKLSQETPAKLILFDMLAGTDGTILTGEPLQTRRACLEAFAKKNAVAEMLESS
PFTLDIKEAERWLTSWEAGATDGVVAKRRDGVYECGERAMVKVKRLKTADCVVGGFRYES
DSSLVGSLLLGLYDTEGLLNHVGFTATISDKERPALTNQLEALREPPGFTGKAPGGPSRW
SSERSGEWEPVRPELVVEVRFDHVSNRRFRHGTKLMRWRPDKDPRQCTYQQIMPS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtccgcacatggaaagccgacgaagaaggccgctccgtcaagcgcggcgaag
aaggcgggcggctttcccctgcccgtcagcacggcgccgatggaggcgcgatccgcgacc
gagcttccgggcggcgacgcatggcagtatgagccgaagtgggacggctttcgctgcctt
gcgttcaagtccggcgacgaagtcgatataagggcgaaatccggcaagccgctcgggcgc
ttcttcccggagatcgtcgccctcttgcgccggctggagccggacatgttcgtcctcgac
ggcgaactggtgatcgaggtcgacgggcgcctctccttcgacgccctgcagatgcgcctg
catccggcggcaagtcgcgtgcagaagctctcgcaggagacgccggccaagctcatcctg
ttcgacatgctggccggcacggacggaacgatcctgaccggtgaacccctccaaacccgc
cgcgcctgcctcgaagcgttcgccaagaagaacgccgttgctgagatgctggagtcttcg
cccttcacgctcgacatcaaggaggccgagcggtggctcacctcatgggaggcgggtgca
accgacggggtggtcgcaaagcggcgcgacggcgtatacgaatgcggcgaaagggcaatg
gtgaaggtcaaacggctgaagacggccgattgcgtcgtcggcggcttccgttacgagagc
gacagctctttggtgggctcgcttctgctcggcctttacgacaccgagggactgctgaac
catgtgggctttaccgcgacgatctcggacaaggagcggcccgccttgaccaaccagctc
gaagcattgcgggagccgccgggcttcaccggcaaagcgccgggcgggcccagccgctgg
agcagcgagcgcagcggcgaatgggagccggttcgcccggaactggtcgtcgaagtccgg
ttcgaccatgttagcaaccggcgcttccgtcacggtacgaaactcatgcgctggcggccg
gacaaggacccgcgccaatgtacctatcagcagatcatgccgtcgtga

DBGET integrated database retrieval system