KEGG   Sinorhizobium meliloti 2011: SM2011_c00768Help
Entry
SM2011_c00768     CDS       T02497                                 

Gene name
aceA
Definition
(GenBank) putative isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00630  Glyoxylate and dicarboxylate metabolism
smel01100  Metabolic pathways
smel01110  Biosynthesis of secondary metabolites
smel01120  Microbial metabolism in diverse environments
smel01200  Carbon metabolism
Module
smel_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smel00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SM2011_c00768 (aceA)
Enzymes [BR:smel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SM2011_c00768 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AGG73292
Position
complement(779982..781271)
Genome map
AA seq 429 aa AA seqDB search
MTDFYKLVPNAPEGRFDGIERPYSAEDVKRLRGSVEIRYSLAEMGANRLWKLIHEEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAAPELAKRINRT
LQRADQIETAEGKGLSVETWFAPIVADAEAGFGGPLNAFEIMKAFIEAGAAGVHYEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTPTLVIARTDAEAAKLLTSDIDERDR
PFVDYDAGRTVEGFYQVKNGIEPCIARAIAYAPHCDLIWCETSKPDLEQARKFAEGVHKA
HPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNYGMFELARG
YRDRQMAAYSELQEAEFAAEANGYTATKHQREVGTGYFDAVSVAITGGQSSTTAMKESTE
HDQFRPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttttacaagctcgttccaaatgcgccggaggggcgcttcgacggaatcgag
cggccctattccgccgaggacgtgaagcggctcaggggctcggtggagatccgttattcg
cttgccgaaatgggggcgaaccgcctctggaagctcattcacgaggaggacttcgtcaac
gcactcggcgcgctttccggcaatcaggcgatgcagatggtgcgcgcaggcttgaaggcg
atctatctctccggctggcaggtcgcagccgacgccaacaccgcttcggccatgtatccg
gaccagtcgctctatccggccaacgcggctccggaactcgccaagcgcatcaaccgcacg
cttcagcgcgccgaccagatcgagacggcggaaggcaagggtctctccgtcgagacctgg
ttcgcgccgatcgtcgccgatgcggaagccggcttcggcgggccgctcaacgccttcgag
atcatgaaggccttcatcgaagcgggtgcggcgggcgtccattacgaggaccagctcgcc
tcggaaaagaagtgcggccatctcggcggcaaggtgctgatcccgaccgcggcgcatatc
cggaatctgaacgcggcacggcttgccgccgacgtgatgggcacgccgacgctggtcatc
gcccgcacggacgcagaagcggcgaaactgctcacctctgatatcgacgagcgcgaccgc
ccattcgtcgactatgatgccggccgcaccgtcgagggcttctaccaggtgaagaacggc
atcgagccctgcatcgcccgcgcgatcgcctatgcgccgcattgcgacctcatctggtgc
gagacctccaagcccgacctggagcaggcgcgcaaattcgccgaaggcgtgcacaaggca
catccgggcaagctgctcgcctataattgctcgccgtccttcaactggaagaagaacctc
gacgacgcaacgatcgccaagttccagcgcgaattgggcgccatgggctacaagttccag
ttcatcaccctcgccggcttccatcagctgaactacggcatgttcgaactggcgcgcggc
tacagggatcgtcagatggcggcctattcggagctgcaggaagcggaattcgctgccgaa
gccaacggctatacggcgaccaagcaccagcgcgaagtgggcaccggctatttcgatgcc
gtgtcggtcgcgatcaccggcggccagtcgtcgaccactgccatgaaggaatccaccgag
cacgatcagttccgcccggcagcagaatga

DBGET integrated database retrieval system