KEGG   Sinorhizobium meliloti 2011: SM2011_c02307Help
Entry
SM2011_c02307     CDS       T02497                                 

Gene name
hisD1
Definition
(GenBank) putative histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00340  Histidine metabolism
smel01100  Metabolic pathways
smel01110  Biosynthesis of secondary metabolites
smel01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smel00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SM2011_c02307 (hisD1)
Enzymes [BR:smel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SM2011_c02307 (hisD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AGG73190
Position
679895..681199
Genome map
AA seq 434 aa AA seqDB search
MAIRLNYLDTSFERDFAAFLTTKREVSEDVNAVVRAIIDDVRARGDAALADYSARFDGID
FTVTGMAVTSAEIDAAIHAVAPEVLGALKVAATRIEAHHRRQLPKDDIYEDQMGVGLGSR
WTPIDAVGLYVPGGTASYPSSVLMNALPAKVAGVPRIVMVVPASGGSINPAVLAAARLAG
VEEIYRIGGAQAVAALAYGTETIEPVAKIVGPGNAYVAAAKRQVFGTVGIDMIAGPSEVL
VIADRDNDPDWIAADLLAQAEHDAGAQAILITDDAAFGDAVEKAVERQLKTLPRAETAAA
SWRDFGAVILVPDFDKAVPLANRIAPEHLELATADPDAMVPAIRNAGAIFIGRHTPEVIG
DYVGGSNHVLPTARSARFSSGLGVLDYVKRTSILRLGPDQLRILGPAAIALARSEGLEAH
ARSVAIRLNLGEEG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatcaggctgaactatctcgatacgagctttgagcgcgatttcgccgcgttcctg
acgaccaaacgggaagtttccgaagacgtcaacgccgtcgtgcgcgccatcatcgacgat
gtccgcgcccgcggagatgcggcgctcgccgactattccgcgcgtttcgacgggatcgac
tttactgtaaccggcatggcggtgacgtcggcggaaatagacgcggcgatccacgcggtc
gctccggaagtactcggcgcattgaaggtcgcggcgacccgcatcgaggcgcatcaccgg
cggcaattgccgaaggacgacatttacgaagaccagatgggcgtcggcctcggctcgcgc
tggacaccgatcgacgcagtcggtctctatgtgccgggcggcacggcgagctatccgagc
tcggttctgatgaacgccctgccggccaaggtcgcaggcgtgccgcgcatcgtcatggtc
gtgccggccagcggcgggtcgatcaatccggcggtgctcgcggccgcccgcctcgccggc
gtcgaggagatctaccgcatcggcggcgcgcaggccgtggcggcgctcgcttacggcacc
gagacgatcgagccggtggcgaagatcgtcggccctggaaatgcctatgtcgcggccgcc
aagcggcaggttttcggcaccgtcggcatagacatgatcgccgggccgtcggaagtgctg
gtgatcgcggaccgcgacaacgatccggattggatcgccgcggacctgctcgcccaggcc
gagcacgacgccggcgcgcaggcaatcctgatcaccgacgatgccgccttcggcgacgcg
gtcgaaaaggcggtggagcgtcagctgaagacgctgccgcgcgccgagacggcggcagcg
agctggcgcgatttcggcgccgtgatcctggttccggatttcgacaaggccgtgccgctc
gccaaccgcatcgccccggaacatctcgagctggcgaccgccgatcccgacgcgatggtc
cccgcgatccgcaatgccggtgcgatcttcatcggcaggcacacacccgaagtcatcggc
gattatgtgggcgggtccaaccacgtgctgccgacggcgcgttcggcgcggttctcctcc
ggcctcggcgtgctcgactatgtgaagcgaacctcgatcctgcggctcggcccggatcag
ttgcgcattctcgggcccgccgcgatcgcgctggcgagatcggaaggcctcgaggcccat
gcccggtcggtcgccatccgcctcaatctcggggaagagggatga

DBGET integrated database retrieval system