KEGG   Sinorhizobium meliloti 2011: SM2011_c03091Help
Entry
SM2011_c03091     CDS       T02497                                 

Gene name
argI1
Definition
(GenBank) putative arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00220  Arginine biosynthesis
smel00330  Arginine and proline metabolism
smel01100  Metabolic pathways
smel01110  Biosynthesis of secondary metabolites
smel01130  Biosynthesis of antibiotics
smel01230  Biosynthesis of amino acids
Module
smel_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:smel00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SM2011_c03091 (argI1)
   00330 Arginine and proline metabolism
    SM2011_c03091 (argI1)
Enzymes [BR:smel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SM2011_c03091 (argI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGG75589
Position
3256637..3257560
Genome map
AA seq 307 aa AA seqDB search
MKTITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLAELGHTVNDEGDLRPLPARDLANH
PGANNLQSVAAFARALDEAVHDTARKGHFPIILGGDHALSMGSVSGMARHAQDVGRPLFV
LWLDAHADFNSPATSPSGNMHGMPVAFFCGEAEFAPILPKDRPLVDPKKVYQVGIRSVDA
REREEIAEHGVNVFDMRAIDEMGMAHIIRQIVDEVRAANGLLHVSLDVDFMDPELAPGVG
TTVPGGATFREAHLIMEVLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRRIL
DRPTRAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatcacattgatcggcgcacccatcgaggaaggctcgggccgccgcggcgca
gccatggggccgacggcgctcaggatcgccggcatagacacggtcctcgccgaactcggc
catacggtcaatgacgagggggatctgaggccgctgcccgcgcgcgatctcgccaaccat
cccggcgccaacaatctgcagtccgttgcagctttcgcgcgcgcgctcgacgaagccgtg
cacgataccgcgcgcaagggacatttccccatcattctcgggggcgaccacgcgctgtcg
atgggcagcgtctccggcatggcgcgtcacgcccaggacgtcggccggcccctcttcgtc
ctctggctcgacgcgcatgccgacttcaactcgcctgcgacctcgccctccggaaacatg
cacggcatgccggtcgccttcttctgcggcgaagcggagttcgccccgatccttccgaag
gaccggccgctggtcgacccgaagaaggtctatcaggtcggaatccgctcggtcgacgcg
cgtgagcgcgaggaaatcgccgagcacggcgtcaatgtcttcgatatgcgggccatcgac
gagatgggcatggcccacatcatccgtcagatcgtcgacgaggttcgcgccgccaacggc
ctgctgcatgtgagcctcgacgtcgatttcatggatccggaacttgcccccggcgtgggc
acgacggtcccgggcggcgcgaccttccgcgaggcgcacctcatcatggaagtgctgtgc
gacagcggcctcgtctcttccctcgatgtcgtcgagctcaacccgttcctcgacgaccgg
ggcaagagcgcgcgcattctggtcgaactgacggcaagcctcttcggccgccgtatcctt
gatcgtccgactcgcgcggcctga

DBGET integrated database retrieval system