KEGG   Sinorhizobium meliloti 2011: SM2011_c03163Help
Entry
SM2011_c03163     CDS       T02497                                 

Gene name
xylA
Definition
putative xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:smel00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:smel00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3121473..3122783)
Genome map
AA seq 436 aa AA seqDB search
MSTGFFGDIAKIKYEGPESTNPLAFRHYNPDDVVLGKRMEDHLRFAVAYWHTFVWPGGDP
FGGQTFERPWFKDSMEAAKLKADVAFEFFQLLGVPYYCFHDADVRPEGRNFAENTSNLNA
IVDYFAGKQGETGVKLLWGTANLFSNRRFMAGAATNPDPDVFAFAAATVKTCIDATQRLD
GENYVLWGGREGYETLLNTDLKRELDQLGRFLNLVVEYKHRIGFKGTILIEPKPQEPTKH
QYDYDVATVYGFLKRYGLENEVKVNIEQGHAILAGHSFEHELALANALGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYHVLAGGGFKTGGTNFDAKLRRQSIDPEDLLIGHIGGMD
CCARGLKAAAKMIEDKALSAPLEARYAGWNVPEAKKMLDGGFSLEEIEAWVLKSDVNPQP
KSGRQELLENVVNRYV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgggatttttcggcgatatcgccaagatcaaatatgagggaccggaaagcacc
aatccgctcgccttccgccattacaatccggacgacgtcgtcctcggcaagcggatggag
gatcatctgcgcttcgccgtcgcctactggcacaccttcgtctggccgggcggcgatccc
ttcggcgggcagaccttcgaacgcccctggttcaaggattcgatggaagccgccaagctg
aaggcggatgtcgccttcgaattcttccagcttctcggcgtaccctactactgcttccac
gacgcggacgtgcgcccggaggggcggaacttcgccgagaacacgagcaatctcaacgcg
atcgtcgattatttcgccgggaagcagggagagaccggcgtcaagctgctgtggggcacg
gcgaacctcttttcaaaccgccgcttcatggcgggggctgcgacgaacccggacccggac
gtcttcgcctttgccgccgcgacggtgaagacctgcatcgacgcgacgcagcggctggat
ggcgagaactatgtgctctggggcggacgcgagggctatgagaccctgctcaacaccgac
ctgaagcgcgagctcgatcagctcggccgcttcctcaacctggtcgtcgaatacaagcac
aggatcggcttcaagggcacgatcctgatcgagccgaagccgcaggagccgaccaagcac
cagtacgactacgacgtcgcgaccgtctatggcttcctcaagagatacggcctcgagaac
gaggtgaaggtcaacatcgagcagggccacgcgatccttgccggacattccttcgagcac
gagctggcgctcgccaatgcgctcggcatcttcggttcgatcgacatgaaccgcaacgac
taccagtccggctgggacaccgaccagttcccgaacaacgtgccggaaatggcgctcgcc
tattaccacgtgcttgcgggcggcggcttcaagaccggcggcacgaacttcgacgcgaag
ctgcgccggcagtcgatcgaccccgaagacctgctgatcggccatatcggcggcatggat
tgctgcgcgcgcggcctcaaggcggccgcgaagatgatcgaggacaaggcgctctccgca
ccgctcgaagcgcgctacgccggctggaacgtgccggaggcgaagaagatgctcgacggc
ggcttctcgctcgaggagatcgaggcctgggtgctcaagtccgacgtcaacccgcagccg
aaatccggcaggcaggagcttctggaaaacgtggtgaaccgctacgtctga

DBGET integrated database retrieval system