KEGG   Sinorhizobium meliloti 2011: SM2011_c03922Help
Entry
SM2011_c03922     CDS       T02497                                 

Gene name
glgB1
Definition
putative 1,4-alpha-glucan branching enzyme (glycogen branching enzyme) protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:smel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SM2011_c03922 (glgB1)
Enzymes [BR:smel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SM2011_c03922 (glgB1)
Exosome [BR:smel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SM2011_c03922 (glgB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3067284..3069494
Genome map
AA seq 736 aa AA seqDB search
MTVPPGKDPAPAPPGMLPAPEIAAILSGTHSNPFAVLGVHAAGKTYVARCFVPGAETVIA
ETLSGKELGTLERRDEAGFFEGPVALRKEQPIRYRARNDGGEWTVIDPYSFGPVLGPMDD
YYIREGSHLRLFDKMGAHPIRHDGAEGFHFAVWAPNARRVSVVGSFNDWDGRRHVMRLRV
DTGIWEIFIPGVPVGTPYKYEIVDSNGTLLPLKADPFARRSELRPDTASMTADEIAQNWE
DEAHRRHWAEIDPRRQPISIYEVHAASWQRRDNGDMLTWDELAERLIPYCVDMGFTHIEF
LPISEYPYDPSWGYQTTGLYAPTARFGEPEGFARFVNGCHKVGIGVILDWVPAHFPTDEH
GLRWFDGTALYEHADPRQGFHPDWNTAIYNFGRQEVVAFLVNNALYWAEKFHVDGLRVDA
VASMLYLDYSRKHGEWVPNEYGGNENLEAVRFLQTMNTRIYGIHQGVLTIAEESTSWPKV
SHPVHAGGLGFGFKWNMGFMHDTLQYLSREPVHRKFHHNDMTFGLLYAFSENFVLPLSHD
EVVHGKGSLIAKMAGDDWQKFANLRAYYGFMWGYPGKKLLFMGQEFAQWREWSEDRGLDW
NLLEYNLHEGMRRLVRDLNGTYRSKPALHARDCEGDGFEWLIADDRENSVFAWLRKAPGE
KLVAVVTNFTPVYREHYDIPLPVAGRWKEVLNTDAEIYGGSGKGNGGAVHAEKRANGETI
ATITLPPLATLMLEQD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgacggttccgcccggcaaggatccagcccccgccccgccaggcatgctgccagcgccg
gaaatcgcggcaatactttccggtacccacagcaaccccttcgccgtccttggagtgcat
gccgcgggcaagacctatgtcgcccggtgcttcgtgccgggtgcggaaacggtgattgcc
gaaacgctcagcggcaaggaactcggcacgctcgagcggcgcgacgaggccggcttcttc
gagggtccggtggcgctccgcaaagagcagcccatccgctaccgcgcccgcaacgacggc
ggcgagtggaccgtcatcgatccctacagcttcggccccgtgctcgggccgatggacgac
tactatatccgcgagggctcgcaccttcgcctcttcgacaagatgggcgcgcatccgatc
cggcatgacggcgccgagggttttcacttcgccgtctgggcgccgaacgcccgccgtgtg
tccgtggtcgggagtttcaacgactgggacggacgccggcatgtcatgcgcctgcgtgtc
gacaccggtatctgggagatcttcatccccggcgtgcccgtgggtacgccctataaatac
gaaatcgtcgacagcaacggcacgctgctgccgttgaaggccgacccctttgcccggcgc
tcggagctcaggcccgacaccgcttcgatgaccgcggacgagatcgcccagaactgggag
gacgaggcgcatcggcgtcactgggccgagatcgatccgcgccggcagccgatctcgatc
tacgaggtccatgcggcctcatggcagcgccgcgacaatggcgacatgctcacctgggac
gaactggcggaaaggctgatcccctattgcgtcgatatgggcttcacgcacatcgagttc
ctgcccatttcggaatatccctatgatccgtcctggggctatcagaccaccggcctctat
gcgccgaccgcacgcttcggcgagccagagggctttgcccgtttcgtcaacggctgccat
aaggtgggcatcggcgtcatcctcgactgggtgccggcgcattttccgaccgacgaacac
gggcttcgctggttcgacggcaccgcgctttacgagcatgcggatccgcgccaggggttc
catcccgactggaacacggcgatctacaatttcggccgtcaggaggtcgtcgcctttctg
gtcaacaacgctctctactgggcggagaaattccatgtcgacggcctgcgcgtcgatgcg
gtcgcctcgatgctctatctcgactattcgcgcaagcatggcgaatgggtgccgaacgaa
tatggcggcaacgaaaatctcgaggccgtgcgtttcctgcagacgatgaacacccgcatc
tacggcatccaccagggcgtgctgaccatcgccgaggaatcgacgtcctggccgaaggtc
tcgcacccggtgcatgccggcgggctcggcttcggcttcaagtggaacatgggcttcatg
cacgacacgctgcaatatctctcgcgcgagcccgtgcaccgaaagttccaccacaacgat
atgaccttcgggctgctctacgccttcagcgagaatttcgtgctgccgctgtcccatgac
gaggtcgtccacggcaaggggtcgctgatcgccaagatggccggcgacgactggcagaag
ttcgccaatctccgcgcctattacggcttcatgtggggctatcccggcaagaagctcctt
ttcatgggacaggaattcgcccaatggcgcgaatggtcggaggaccgcggtctcgactgg
aacctgctcgaatacaatctgcatgaggggatgcgccgtctggtgcgcgacctgaacggc
acctatcgctcgaagccggcgctgcatgcgcgcgactgcgagggcgacggtttcgaatgg
ctgattgccgacgatcgtgagaattccgtcttcgcctggctgaggaaagcgcccggagag
aagctggtcgcggtcgtcaccaacttcactccggtttaccgggagcattacgacataccg
cttccggtggcagggcgctggaaggaagtcctcaataccgacgcggaaatctatggagga
agtggcaagggcaacggcggcgccgtccatgcagagaagagagcgaacggagagacgatc
gccaccatcacgctgccgcctctggcgacgctgatgctggagcaggattag

DBGET integrated database retrieval system