KEGG   Sinorhizobium meliloti 2011: SM2011_c04122Help
Entry
SM2011_c04122     CDS       T02497                                 

Gene name
deoA
Definition
putative thymidine phosphorylase transmembrane protein (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smel00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SM2011_c04122 (deoA)
Enzymes [BR:smel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SM2011_c04122 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
152705..154027
Genome map
AA seq 440 aa AA seqDB search
MAMLPQEIIRKKRDGDRLDPAEIAGFIAGVTDGSVSEGQAAAFAMAVWFSGMNRDECVAL
TLAMRDSGETLDWSDLARPIVDKHSTGGVGDNVSLMLAPIVAACGAAVPMISGRGLGHTG
GTLDKLESIPGYDIQPSPELFRRVADEVGCAIIGQTADLAPADKRLYAIRDVTATVDSVP
LITASILSKKLAAGLRSLVLDVKLGNGSFMTDPAETEVLARSLVEVANGAGVRTSALITD
MNEPLADAAGNALEIENCLAYLRGEKAGTRLDQVVMALAAEMLVAAGIAAHEAEAEAMAR
RVLGSGEAMERFGLMVHRLGGPADFVDRPGAYLAKAPAILAVPAGRHGYLTSCKTRELGM
AVIELGGGRIRPDDRIDHRVGLTGLRPLGTKVEKGEPIAFVHAADQSQAEAIAKRVVTLY
AIADEEPARRPVIVSKLRAG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcttccgcaggaaatcatacgaaagaaaagggacggcgatcggctcgatccg
gcggagatcgccggtttcatcgcgggcgtgaccgatggctcggtctcggaagggcaggcg
gctgccttcgccatggcggtctggttctccggcatgaatcgcgacgaatgcgtggcgctg
acgctggcgatgcgcgattccggggaaacgctcgactggagcgatctcgcacgccccatt
gtcgacaagcactcgacgggcggagtcggcgacaatgtctcgctcatgttggcgccgatc
gtcgccgcctgcggtgcggccgtgccgatgatttcgggccgggggctcggccacaccggc
gggacgctcgacaagctcgaatcgatccccggctatgacatccagccttcgccggaactg
ttccgccgcgtggccgacgaggtcggctgcgcgatcatcggccagacggccgatctggcg
ccggccgacaagcgcctctatgcgatccgcgacgtgacggcgacggtcgattcggtgccg
ctgatcaccgcatcgatcctgtcgaaaaagctcgccgcagggctacggtcgctggtgctc
gacgtcaagctcggcaacggctccttcatgaccgatcctgccgaaaccgaagtcctggcg
cgttcgcttgtcgaggtcgccaatggtgcgggcgtgcgcacctctgcgctgatcaccgac
atgaacgagccgctggcggacgcggccggcaacgcgctcgaaatcgagaactgcctggcc
tatctgcgcggcgagaaagcgggaacccgcctcgatcaggtcgtgatggccttggctgcg
gagatgctcgttgcagcgggtattgcggctcacgaagccgaagccgaagccatggcgcgg
cgcgttttggggagcggggaggcgatggagcgcttcggcctcatggtgcatcggctcggc
ggccctgccgattttgtcgatcgcccgggcgcctatcttgccaaggcacccgcgatcctt
gccgtgccggcgggccggcatggttatctcacgtcctgcaagacgcgcgaactgggaatg
gcagtcatcgagctcggcggcgggcgcatccgcccggatgaccggatcgatcaccgcgtc
ggtcttaccggcctgaggccgctcgggacgaaagtcgaaaagggcgagccgatcgccttc
gtccatgctgccgaccaaagccaggccgaggcgatcgcaaaacgggtcgtaacgctctat
gcgatcgcagacgaggagccggcgcgacggccggtgatcgtttcgaagctcagagcggga
tga

DBGET integrated database retrieval system