KEGG   Streptobacillus moniliformis: Smon_0037Help
Entry
Smon_0037         CDS       T01125                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
smf  Streptobacillus moniliformis
Pathway
smf00010  Glycolysis / Gluconeogenesis
smf00052  Galactose metabolism
smf00500  Starch and sucrose metabolism
smf00520  Amino sugar and nucleotide sugar metabolism
smf01100  Metabolic pathways
smf01110  Biosynthesis of secondary metabolites
smf01120  Microbial metabolism in diverse environments
smf01130  Biosynthesis of antibiotics
smf01200  Carbon metabolism
Module
smf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smon_0037
   00052 Galactose metabolism
    Smon_0037
   00500 Starch and sucrose metabolism
    Smon_0037
   00520 Amino sugar and nucleotide sugar metabolism
    Smon_0037
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smon_0037
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Smon_0037
Enzymes [BR:smf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Smon_0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ACZ00534
UniProt: D1AW58
Position
35670..36623
Genome map
AA seq 317 aa AA seqDB search
MKYFVGVDLGGTNVKIGILDSEYNILTEESIKTESKRGPEDTFTRIWNKIQELFTKISVD
ISELEGIGFGIPGPVVNKSIVKIAANFSWGNDFNAKELFERISGKTVIVENDVRAIALGE
NLFGASKGYKNSIILPIGTGIAAGMIINGELISGNDGAAGEIGHISVDLNGYKCGCGLTG
CLELFTSAKGIVREGIKVLKQEKKGILYETFKDDFEKLEAFHIFLEARKGDEVAEIIVDN
FCNKLAYGIGVLINLVNPEIIVIAGGLAKSSDLIIAGVKKHLPKYALNMSIDIPIVKSEL
LDSAGVKGAASLIINKK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactttgttggagtagatttaggtgggaccaatgttaaaataggaatattagat
tcagaatataatatattaacggaagaaagtattaaaacagaatcaaaaagaggacctgaa
gatacatttactagaatttggaataaaatacaagagctatttacaaaaatatcagtagat
atatcagaacttgagggtataggatttggtattcctggaccagtggttaataaatctata
gttaaaatagcagctaatttttcatggggtaatgattttaatgctaaggaactatttgaa
agaatttcaggtaaaactgtaatagttgaaaatgatgtaagagcaatagcattaggagaa
aatttatttggtgcaagtaaagggtataaaaatagtataattttacctataggaactgga
attgcagcaggtatgataataaatggagaactgatatcaggaaatgatggagctgctgga
gaaataggacacatttcagttgatttaaatggatataaatgcggttgtggattaactggt
tgtttagaactatttacatcagctaaaggtatagtaagagaaggaattaaagtgttaaaa
caagagaaaaaaggtattctttatgaaacttttaaagatgactttgaaaagcttgaagca
tttcatattttcttagaagcaagaaaaggagatgaagttgcagaaattatagttgataat
ttttgtaataaattagcctatggaataggagtattaatcaatttagttaatcctgaaata
atagttattgcaggtggattagctaaatcttcagatttaattatagcaggagttaaaaaa
catttacctaaatatgctttaaatatgagtattgatatacctatagttaaaagtgagtta
ttagattcagctggagtaaaaggagctgcatcgttaattataaataaaaaataa

DBGET integrated database retrieval system