KEGG   Streptobacillus moniliformis: Smon_0037Help
Entry
Smon_0037         CDS       T01125                                 

Definition
(RefSeq) ROK family protein
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
smf  Streptobacillus moniliformis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smon_0037
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smon_0037
   00052 Galactose metabolism
    Smon_0037
   00500 Starch and sucrose metabolism
    Smon_0037
   00520 Amino sugar and nucleotide sugar metabolism
    Smon_0037
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smon_0037
   00524 Butirosin and neomycin biosynthesis
    Smon_0037
Enzymes [BR:smf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Smon_0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35670..36623
Genome map
AA seq 317 aa AA seqDB search
MKYFVGVDLGGTNVKIGILDSEYNILTEESIKTESKRGPEDTFTRIWNKIQELFTKISVD
ISELEGIGFGIPGPVVNKSIVKIAANFSWGNDFNAKELFERISGKTVIVENDVRAIALGE
NLFGASKGYKNSIILPIGTGIAAGMIINGELISGNDGAAGEIGHISVDLNGYKCGCGLTG
CLELFTSAKGIVREGIKVLKQEKKGILYETFKDDFEKLEAFHIFLEARKGDEVAEIIVDN
FCNKLAYGIGVLINLVNPEIIVIAGGLAKSSDLIIAGVKKHLPKYALNMSIDIPIVKSEL
LDSAGVKGAASLIINKK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactttgttggagtagatttaggtgggaccaatgttaaaataggaatattagat
tcagaatataatatattaacggaagaaagtattaaaacagaatcaaaaagaggacctgaa
gatacatttactagaatttggaataaaatacaagagctatttacaaaaatatcagtagat
atatcagaacttgagggtataggatttggtattcctggaccagtggttaataaatctata
gttaaaatagcagctaatttttcatggggtaatgattttaatgctaaggaactatttgaa
agaatttcaggtaaaactgtaatagttgaaaatgatgtaagagcaatagcattaggagaa
aatttatttggtgcaagtaaagggtataaaaatagtataattttacctataggaactgga
attgcagcaggtatgataataaatggagaactgatatcaggaaatgatggagctgctgga
gaaataggacacatttcagttgatttaaatggatataaatgcggttgtggattaactggt
tgtttagaactatttacatcagctaaaggtatagtaagagaaggaattaaagtgttaaaa
caagagaaaaaaggtattctttatgaaacttttaaagatgactttgaaaagcttgaagca
tttcatattttcttagaagcaagaaaaggagatgaagttgcagaaattatagttgataat
ttttgtaataaattagcctatggaataggagtattaatcaatttagttaatcctgaaata
atagttattgcaggtggattagctaaatcttcagatttaattatagcaggagttaaaaaa
catttacctaaatatgctttaaatatgagtattgatatacctatagttaaaagtgagtta
ttagattcagctggagtaaaaggagctgcatcgttaattataaataaaaaataa

DBGET integrated database retrieval system