KEGG   Streptobacillus moniliformis: Smon_0361Help
Entry
Smon_0361         CDS       T01125                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
smf  Streptobacillus moniliformis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:smf00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:smf00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
421730..422998
Genome map
AA seq 422 aa AA seqDB search
MVEGFKIEGKRPLNGIIEVSGAKNAALPIIIATLIEKGEHILRNVPDLRDIRILFQLLED
FGMKVEKLDSNSYKIINDGFKRNEASYEIVKQMRASFLVMGPMVANLQESVVSLPGGCAI
GSRPVDIHLKGFEALGAEITQIRGYIHVVAENLKGADIALTFPSVGATQNLLMAAVKISG
TTRIINAAKEPEIVDLGNYLIKMGAKIEGLGTNTITIEGVEKLHAVEYSIMPDRIEAGTY
VIASIVTDGDLKIKNANIEDLGVFKHQLEAMGVKFEKNGDILTVKGKVKDLKPTRIVTMP
HPGFPTDMQAQMMLLLSLIKGHSEVEETVFENRFMHVPELNRMGADINIRHGIANVEGVE
NLYGTNVMASDLRAGAALVVAGLIADGDTILSRIYHIDRGYDKLEEKLNKVGAKIERIKL
EV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaggatttaaaatagaaggtaaaagacctctaaatggtataatagaagtaagt
ggagcaaagaatgctgctcttccaataataatagcaacacttatagaaaaaggggaacat
atattaagaaatgtacctgatttaagagatattagaatactatttcaactactagaagat
tttggaatgaaagttgaaaaattagatagtaatagttataaaataattaatgatggcttt
aagagaaatgaagcaagttatgaaatagttaaacaaatgagagcttcatttttagttatg
gggcctatggttgctaatttacaagaatctgtagtttctcttccaggaggttgtgctata
ggaagtagacctgttgatatacacttaaaaggatttgaagcattaggagcagaaattact
caaataagaggatatattcatgttgttgctgaaaatcttaaaggagcagatatagcttta
actttcccatcagttggggcaacacaaaatttactaatggcagcagttaaaatttcaggt
actactagaataattaatgctgcaaaagaaccagaaatagtagatttaggaaattattta
ataaaaatgggtgcaaaaattgaaggacttggaactaacactataactattgaaggtgta
gagaaattacatgcagttgaatattcaattatgcctgatagaatagaagcaggaacatat
gttattgcatctatagttacagatggagatcttaaaattaaaaatgcaaatattgaagat
ttaggtgtatttaaacatcaacttgaagctatgggagttaagtttgaaaaaaatggagat
atattaactgttaaagggaaagttaaagatttaaagcctactagaatagttactatgcca
catccaggtttcccaacagatatgcaagctcaaatgatgttattgctttcattaattaaa
ggacatagtgaagtagaagaaactgtgtttgaaaatagatttatgcatgtacctgaatta
aatagaatgggtgcagatattaatataagacatgggatagcaaatgttgaaggtgtagaa
aacctttatggaactaatgtaatggcatctgatttaagggcaggagctgcattagttgta
gctggtcttatagcagatggagatacaattttaagtagaatttatcatatagatagagga
tatgataaattagaagagaaattaaataaagttggagctaagatagaaagaataaaactt
gaagtttaa

DBGET integrated database retrieval system