KEGG   Streptobacillus moniliformis: Smon_0412Help
Entry
Smon_0412         CDS       T01125                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
smf  Streptobacillus moniliformis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smon_0412
   01230 Biosynthesis of amino acids
    Smon_0412
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smon_0412
   00030 Pentose phosphate pathway
    Smon_0412
   00051 Fructose and mannose metabolism
    Smon_0412
   00052 Galactose metabolism
    Smon_0412
  Energy metabolism
   00680 Methane metabolism
    Smon_0412
Enzymes [BR:smf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Smon_0412
Protein phosphatases and associated proteins [BR:smf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Smon_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
483232..484197
Genome map
AA seq 321 aa AA seqDB search
MKKIAILTSGGDSQGMNTAIRVVAKTAMHKGIEVYGIRRGYKGILNRDIFKMSLLDVAGL
AGKGGTMLLSARLPEFKDPEVRTRAANILKEFGIEGLVVIGGDGSFHGAHYLYEEHGIKT
IGIPGTIDNDIAGTDYTIGYDTALNIILESFNQIRDTAKSHDRTFFIEVMGRNCGDLALN
AGIAAGANGILIPEVETSIEDIINIIQKRREAGKFYDVIIMSEGYKNKENILKELKERMP
ELDVKHTALSHIQRGGNPTAADRLLATRLGVRAVELLLEGKSGLMVGIESSTVVTHKLSY
AWENYHKKSQEDYDIAMMLSV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagcaatcttaactagtggtggagattcacaaggaatgaataccgctata
agagtagttgctaaaactgctatgcataagggtatagaagtttatggaattagaagaggg
tataaaggaattttgaatagagatatatttaaaatgtcattacttgatgtagctggtctt
gcaggaaaaggtggtactatgttattatcagcaagattaccagaatttaaggacccagaa
gtaagaactagagcagctaatattttaaaagaatttggtattgaaggattagtagtaata
ggtggagatggttctttccacggtgctcattatttatatgaagagcatggaataaaaact
ataggaatacctggaactatagataatgatattgcaggaacagattatactataggttat
gatacagcattaaatataatacttgaatcatttaaccaaattagagatactgctaaatct
catgatagaactttctttatagaagttatgggaagaaattgtggagatctagctttaaat
gctggaattgcagcaggagcaaatggtatattaattccagaggttgaaacttctattgag
gatataataaatattatacaaaaaagaagagaagctggaaaattctatgatgtaataata
atgtcagaaggatataaaaacaaagagaatatacttaaggaattaaaagaaagaatgcct
gagttagatgttaaacatactgcattatcacatattcaaagaggtggaaatcctacagca
gcagatagattacttgctacaagattaggagttagagcagtagaattattattagaagga
aaatcaggtttaatggttggaattgaaagctcaactgtagtaactcacaaattatcatat
gcatgggaaaattatcataaaaaatctcaagaagattatgatattgcaatgatgttatca
gtttaa

DBGET integrated database retrieval system