KEGG   Streptobacillus moniliformis: Smon_0414Help
Entry
Smon_0414         CDS       T01125                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
smf  Streptobacillus moniliformis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Smon_0414
DNA repair and recombination proteins [BR:smf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Smon_0414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
485727..486314
Genome map
AA seq 195 aa AA seqDB search
MKKIDELVLVLSNLKGIGKKNATRIAFDLLSKDEDDINYLLYTIKSAYENIKPCSVCHNL
TDLGICDICSSTNRNKNVICVVEDTRDIYAFNKASSYNGLYHVLGGKIDPLNGIGIDELN
IDSLLSRIDENINEVILALNPDLEGETTILYLTKLLSNMNVKVSRIASGIPIGGNIEYSD
SATLIKSLEGRVIIK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgatgaattagtgctagtattatctaatttaaagggtataggtaaaaaa
aatgcaactagaattgcttttgatttactttcaaaagatgaagatgatataaactatctg
ttatataccattaagagtgcatatgaaaatataaagccatgcagtgtatgccataattta
actgatttaggcatatgtgatatatgtagttctactaatagaaataaaaatgtaatttgt
gtagtagaagacacaagggatatttatgctttcaataaggcaagttcatataatggacta
tatcatgtattaggtggtaaaatagatccattaaatggtataggtatagatgaattaaat
atagatagtcttttatcgagaatagatgaaaatataaatgaggtaattctcgcactaaat
cctgatttagaaggagaaacaactatactttatctgacaaaattattaagtaatatgaat
gttaaagttagtagaatagcaagtggaatacctataggtggaaatatagagtattctgat
agtgctactttaattaaatcattagaaggtagagtaataataaaataa

DBGET integrated database retrieval system