KEGG   Streptobacillus moniliformis: Smon_0414Help
Entry
Smon_0414         CDS       T01125                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
smf  Streptobacillus moniliformis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:smf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
485727..486314
Genome map
AA seq 195 aa AA seqDB search
MKKIDELVLVLSNLKGIGKKNATRIAFDLLSKDEDDINYLLYTIKSAYENIKPCSVCHNL
TDLGICDICSSTNRNKNVICVVEDTRDIYAFNKASSYNGLYHVLGGKIDPLNGIGIDELN
IDSLLSRIDENINEVILALNPDLEGETTILYLTKLLSNMNVKVSRIASGIPIGGNIEYSD
SATLIKSLEGRVIIK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgatgaattagtgctagtattatctaatttaaagggtataggtaaaaaa
aatgcaactagaattgcttttgatttactttcaaaagatgaagatgatataaactatctg
ttatataccattaagagtgcatatgaaaatataaagccatgcagtgtatgccataattta
actgatttaggcatatgtgatatatgtagttctactaatagaaataaaaatgtaatttgt
gtagtagaagacacaagggatatttatgctttcaataaggcaagttcatataatggacta
tatcatgtattaggtggtaaaatagatccattaaatggtataggtatagatgaattaaat
atagatagtcttttatcgagaatagatgaaaatataaatgaggtaattctcgcactaaat
cctgatttagaaggagaaacaactatactttatctgacaaaattattaagtaatatgaat
gttaaagttagtagaatagcaagtggaatacctataggtggaaatatagagtattctgat
agtgctactttaattaaatcattagaaggtagagtaataataaaataa

DBGET integrated database retrieval system