KEGG   Streptobacillus moniliformis: Smon_0420Help
Entry
Smon_0420         CDS       T01125                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smf  Streptobacillus moniliformis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Smon_0420
Enzymes [BR:smf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Smon_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
493283..494779
Genome map
AA seq 498 aa AA seqDB search
MEQNFDYKHINKNRKSAIIMHISSLWNEYGIGNLGKEAYEFADFLKASGQYYWQILPTGP
TGYGDSPYQSFSSFAGNPYFIDFRILEEEGLLNREDYENLDYGNDPNRVDFGKIYLTRKE
VLSKAFENFKNIEDEKYNIFITENSDWIHDYSLFMALKEHFGNISWEDFPQEIKDRNLEE
LDKYEILLKDKINYQKFIQYKFFSQYKKWKEYVNSLGIKIIGDMPIYVSPDSLEVWKDRE
LFLDNIVGGCPPDGFSAGGQKWGNPVYAWEKHMETGFKWWINRIEKTMKYIDVLRIDHFR
GFESYWAVPKFDEDARNGKWVKAPGVELFEAIEKALGKIDIVAEDLGYTTVEVVKFREKT
GFPGMKMLQFAFNPENESDFLPHQIERNWAVYTGTHDSDTVKTWFDRANPIEVEFAKKYL
HLTDPKDYVKGFIRAAWSSVANLAVAQMQDFLELGDEGRMNTPSTLGNWSWRVRKEMLTK
ELSKEIYDLTKTYFRLND
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaattttgattacaaacatattaataagaataggaaaagtgcaataattatg
cacatttcttcattatggaatgaatacggaataggtaatttaggaaaagaagcttatgaa
tttgctgattttcttaaagcatctggtcaatattattggcaaatattacctacaggtcct
acaggttatggagattcaccttatcaatctttttcatcatttgcaggtaatccatatttc
atagattttagaatacttgaagaagaaggattacttaacagagaagattatgaaaattta
gattatggaaatgaccctaatagagtagattttggtaaaatttatttaacaagaaaagaa
gtactttcaaaagcttttgaaaactttaaaaatatagaagatgaaaaatataatatattt
ataactgaaaattctgattggattcatgactattctttatttatggcattaaaggaacat
tttggtaatatttcttgggaagattttccacaagaaattaaagatagaaatttagaagaa
ttagataagtatgaaatattattaaaagataagataaattatcaaaaatttatacagtat
aaattcttttctcagtataaaaaatggaaagaatatgttaattctttaggtattaaaatt
ataggtgatatgcctatttatgtttcgcctgatagtttagaggtttggaaggatagagaa
ttattcttagataatatagtaggaggttgcccaccagatggatttagtgcaggagggcaa
aaatggggaaatcctgtatatgcttgggaaaaacatatggaaactggatttaaatggtgg
ataaatagaatagaaaaaacaatgaaatatattgatgtattaagaatagatcattttaga
ggatttgaatcatattgggcagttcctaaatttgatgaagatgcaagaaatggtaaatgg
gtaaaagcacctggagtagaattatttgaagctatagaaaaagctttaggtaaaatagat
atagttgctgaagatttaggatatacaactgtagaagtagttaaatttagagaaaaaaca
ggatttccaggtatgaaaatgttacagtttgcatttaatcctgaaaatgaaagtgatttc
ctgccacatcaaatagaaagaaattgggcagtatatacaggaactcatgatagtgatact
gttaaaacatggtttgatagagcaaatcctatagaggtagaatttgctaaaaaatatcta
catttaacagatcctaaagattatgttaaaggatttattagagctgcatggtcatctgta
gctaatttagcagtagcacaaatgcaagactttttagaacttggtgatgaaggtagaatg
aatacgccttcaactttaggaaattggtcttggagagttagaaaagaaatgttgactaaa
gaattaagtaaagaaatttatgatttaacaaaaacatatttcagattaaatgattaa

DBGET integrated database retrieval system