KEGG   Streptobacillus moniliformis: Smon_0483Help
Entry
Smon_0483         CDS       T01125                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
smf  Streptobacillus moniliformis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:smf00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
564756..565301
Genome map
AA seq 181 aa AA seqDB search
MKGKLFIVSGPSGSGKSTVTKLVRDMLNIPLAISVTTRQIRTGEVDGKDYYFITKEEFEK
KINENGLFEYANVHGNYYGTLNSEIEKHLENGQNVILEIDVQGGVIAKNKRNDSILIFFK
APSLEELEKRLRGRNTDSEKVIKKRLENALKELEYEKDYDYTIINYDIEDSCKQLINIIE
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggaagttattcatagtttcaggaccatcaggttctggaaaatcaactgttaca
aaactagtaagagatatgttaaatatacctttagcaatttctgtgactactcgtcaaatt
agaactggagaagttgatggtaaagattattactttataactaaagaagaatttgaaaag
aaaattaatgaaaatggattatttgaatatgcaaatgttcatggtaattattatggtact
ttaaattctgagattgaaaaacatttagaaaatggtcaaaatgttattcttgaaatagat
gtacaaggtggagttatagctaaaaataaaagaaatgactctattttaatattctttaaa
gctcctagtcttgaagaattagaaaaaagattaagaggaagaaatacagatagtgaaaaa
gtaataaagaaaagattagaaaatgctcttaaagaacttgaatatgaaaaagattatgat
tatacaataattaattatgatattgaagattcttgtaagcagcttattaacatcatagag
gactaa

DBGET integrated database retrieval system